(data stored in ACNUC1104 zone)

EMBL: BX640427.PE256

BX640427.PE256       Location/Qualifiers
FT   CDS_pept        260698..261624
FT                   /transl_table=11
FT                   /locus_tag="BPP1547"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1440"
FT                   /db_xref="GOA:Q7WA42"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA42"
FT                   /protein_id="CAE36849.1"
FT                   /translation="MIDVSTVVLIVIVILALMIVVKAIAIVPQQHAWVVERLGKFDRVL
FT                   SPGAGFVIPFIERVSYKHSLKEIPLDVPSQVCITRDNTQLQVDGVLYFQVTDPMRASYG
FT                   SSNYISAITQLAQTTLRSVIGKLELDRTFEEREFINSTIVASLDEAALNWGVKVLRYEI
FT                   KDLTPPNEILRAMQAQITAEREKRALIAASEGRRQEQINIATGEREAAIARSEGEKQAQ
FT                   INQAQGEAAAVLAIAEATAKAIEQVGEAVRQPGGMEAVNLKVAERYVDAFSNVAKEGNT
FT                   LILPSNLSDVGGLIASAMTIVKSTKSA"
     atgatcgacg tttccactgt ggtcctgatt gtcatcgtca tcctggcgct gatgatcgtg        60
     gtcaaggcca tcgccatcgt gccgcagcag catgcctggg tggtggagcg gctgggcaag       120
     ttcgaccgcg tgctgtcgcc gggcgccggc ttcgtgattc ccttcatcga acgggtgtcg       180
     tacaagcatt cgctcaagga aatcccgctc gacgtgccga gccaggtctg catcacgcgc       240
     gacaacacgc agttgcaggt cgacggcgtg ctgtacttcc aggtcaccga tccgatgcgc       300
     gcttcgtacg gctcgtcgaa ctacatttcc gccatcaccc agctggcgca gacgacgctg       360
     cgctcggtga tcggcaagct ggagctggac cgcacgttcg aggagcgcga gttcatcaac       420
     agcaccatcg tcgcgtcgct ggacgaggcc gcgctgaact ggggcgtgaa ggtgctgcgc       480
     tacgagatca aggatttgac gccgcccaac gagatcctgc gcgcgatgca ggcgcagatt       540
     accgccgagc gcgagaagcg cgccctgatc gcggcttccg aggggcgccg ccaggagcag       600
     atcaacatcg ccaccggcga gcgcgaggcc gccatcgcgc gctccgaagg cgagaagcag       660
     gcgcagatca accaggccca gggcgaggcc gcggccgtgc tggccatcgc cgaggcgacc       720
     gccaaggcga tcgagcaggt gggcgaggcc gtgcgccagc ccggcggcat ggaagccgtc       780
     aacctcaagg tcgccgaacg ctacgtggat gccttcagca atgtggccaa ggagggcaat       840
     acgctcatcc tgccgtccaa cctgtccgat gtgggcgggc tcatcgcctc ggccatgacg       900
     atcgtcaagt cgaccaagag cgcgtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page