(data stored in ACNUC1104 zone)

EMBL: BX640427.PE260

BX640427.PE260       Location/Qualifiers
FT   CDS_pept        263780..264130
FT                   /transl_table=11
FT                   /locus_tag="BPP1551"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1444"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA39"
FT                   /protein_id="CAE36853.1"
FT                   /translation="MANDTPAPAGSLRVTVCHACPDGAWQRAVTLPAGATVADAVAASG
FT                   FAAAHRGQDPWAHGVGVFGKAQAADAPLADGDRVEIYRGLSFDPKESRRRRAEHRRALA
FT                   ARGGKARPAGLL"
     atggcgaatg acacgccggc gcccgccggt tcgctgcgcg tgacggtctg ccatgcatgc        60
     ccggacgggg catggcagcg cgccgtcacg ctgccggccg gcgccacggt ggccgacgcg       120
     gtggccgcca gcggctttgc cgcggcgcac cgcggccagg atccctgggc gcatggcgtg       180
     ggggtgttcg gcaaggcgca ggcggctgac gcgccgctgg ccgatggcga ccgggtggaa       240
     atctaccggg gcctcagctt cgatcccaag gagtcgcgcc ggcggcgggc cgagcaccgg       300
     cgtgcgctgg ccgcgcgcgg cggcaaggcg cgtccggccg gcctgctgta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page