(data stored in ACNUC1104 zone)

EMBL: BX640427.PE265

BX640427.PE265       Location/Qualifiers
FT   CDS_pept        268134..268823
FT                   /transl_table=11
FT                   /locus_tag="BPP1556"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1449"
FT                   /db_xref="GOA:Q7WA34"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA34"
FT                   /protein_id="CAE36858.1"
FT                   /translation="MPARSHHRIFRSGWLRAAVLGANDGIVSTASLIAGVAAAQASHAA
FT                   ILTSGLAGLVAGALSMAAGEYVSVKSQADIEAADLRLEQSSLKRNSREELEELTGIYVE
FT                   RGLSPDLAGQVARQLTRHNALDAHARDELGISVHNRAQPVQAALASAASFAVGAALPLA
FT                   IAMAAPLAQLMPVVIAGSVAGLGILGAVAARAGGAPVGPAAVRVVLLGAAAMALTAGVG
FT                   ALFGVAV"
     atgcccgccc gatcccacca tcgcatcttc cgttccggct ggctgcgcgc cgcggtgctg        60
     ggcgccaatg acggcatcgt ctccaccgcc agcctgatcg ccggggtggc ggccgcgcaa       120
     gccagccatg ccgccatcct gacttcgggc ctggccggcc tggtggccgg agcgctgtcc       180
     atggccgccg gcgagtacgt atcggtgaag tcccaggccg atatcgaggc ggccgatctg       240
     cggctggaac agagttcgct caagcgcaat tcgcgcgaag agctggaaga actgaccggc       300
     atctatgtcg agcgcggcct gtcgcccgac ctggcggggc aggtggcccg gcagctgacg       360
     cgccacaacg ccctggacgc gcatgcgcgc gacgagctgg gcatctcggt gcacaaccgc       420
     gcccagccgg tgcaggcggc gctggcctcg gccgcgtcgt tcgccgtcgg ggcggcgctg       480
     ccgctggcca tcgccatggc ggcgccgctg gcgcaactga tgccggtggt gatcgccggg       540
     tcggtggccg ggctgggcat actgggcgcg gtggccgcgc gcgccggcgg cgcgccggtg       600
     gggccggccg ccgtgcgggt ggtgttgctg ggggcggccg ccatggccct gaccgcgggc       660
     gtgggggcct tgttcggcgt ggcggtatag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page