(data stored in ACNUC1104 zone)

EMBL: BX640427.PE266

BX640427.PE266       Location/Qualifiers
FT   CDS_pept        complement(268833..269849)
FT                   /transl_table=11
FT                   /locus_tag="BPP1557"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1845"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA33"
FT                   /protein_id="CAE36859.1"
FT                   /translation="MHAFYDSIPARADGSAQCAPLASLRVIGAAGADALAFLHGQLTQD
FT                   VTGQPADHARLAGYCTAKGRLLATLVMWRAAAADESAPVWQALVRADVAEAVLKRLSMF
FT                   VLRAKARLAPVPAWAAGVQCAPAALAALQDAAGGALPAAPWQRAELPTGTWIGAPSADA
FT                   QPRWWWIATEAQLERAGALAAHLGRASESAWQAADLAAGLPWIGAATQDVFIPQTVNLD
FT                   LIGGVSFTKGCYPGQEVVARSHYRGTVKRRMAHGVIAEAPADLPDPLAGQDIYDSARPD
FT                   EPCGRVVDAARSDGQLALLFETTLASLPDGDLRLLSAQGPRIALAPLPYELAGNAAG"
     atgcacgctt tctacgattc gattcccgcg cgcgccgatg gttcggcgca atgcgcgccg        60
     ctggccagcc tgcgcgtcat cggcgcggcc ggcgccgacg cgctggcttt cctgcatggg       120
     caactgaccc aggacgtcac cggccagccc gccgaccacg cccgcctggc cggctactgc       180
     accgccaagg gccgcctgct ggccacgctg gtcatgtggc gggccgccgc ggccgacgaa       240
     agcgccccgg tatggcaggc gctggtgcgc gccgacgtcg ccgaggcggt gctcaagcgc       300
     ctgtccatgt tcgtattgcg cgccaaggcg cggctggctc cggtgccggc gtgggcggcg       360
     ggcgtgcaat gcgcccccgc cgcgctggcc gcgctgcagg acgccgccgg cggcgccctg       420
     cccgccgcgc cctggcagcg cgccgaattg cccaccggca cctggatcgg cgcgccctcg       480
     gccgatgcgc agccgcgctg gtggtggatc gccaccgaag cgcagctgga gcgggccggc       540
     gcgctggccg cgcacctggg ccgcgcgtcc gagtccgcct ggcaggccgc cgacctggcc       600
     gccggcctgc cctggatcgg cgcggccacg caggacgtct tcattccgca gaccgtcaat       660
     ctcgacctca tcggcggcgt cagcttcacc aagggctgct atccgggcca ggaggtggtg       720
     gcgcgcagcc attaccgcgg cacggtcaag cgccgcatgg cccatggcgt gatcgccgag       780
     gccccggccg acctgcccga ccccttggcc ggccaggaca tctacgacag cgcgcggccg       840
     gacgaaccct gcggacgcgt ggtcgacgcc gcgcgcagcg acgggcagct cgcgctgctg       900
     ttcgaaacca ccctggccag cctgcccgac ggcgacctgc ggctgctcag cgcgcagggc       960
     ccgcgcatcg ccctggcgcc cctgccctac gaactggccg gcaacgccgc cggctag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page