(data stored in ACNUC1104 zone)

EMBL: BX640427.PE267

BX640427.PE267       Location/Qualifiers
FT   CDS_pept        270016..271062
FT                   /transl_table=11
FT                   /locus_tag="BPP1558"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1846"
FT                   /db_xref="GOA:Q7WA32"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA32"
FT                   /protein_id="CAE36860.1"
FT                   /translation="MRTLMRKRIRFYFLLLVLVALLGAALAAGGAWTWMHRPVALKSDR
FT                   IDFVVDPGSTPRAIARTLNQAGVAVWEPGFVWMARLSELDKQIKAGGYQAIDGDSPWQL
FT                   LQRLARGDMSQRQITFLEGWMFRQMRQALREHPDVKQTLGETSDEALMERLGSTVTHPE
FT                   GMFFPDTYVFTPGSTDFDILRRAYQEGQRILESTWAKRQDGLPVGTPYEALILASIVEK
FT                   ETGHGPERARVAGVFANRLRIGMLLQTDPTVIYGMGEAYQGRIRKRDLQTDTPWNTYTR
FT                   PGLPPTPIAAPGRAALLAAVQPERHKYLFFVSRGNGTSEFSVNLNDHNRNVSRYILGQG
FT                   QPQQGSQQ"
     ttgcgcacac ttatgagaaa acgcattcgt ttctattttc tgctgctcgt gctggtggcg        60
     ctgctcggcg ccgcgctggc ggccggcggc gcctggacct ggatgcacag gccggtggcg       120
     ctcaagtccg accgcatcga tttcgtggtg gatccgggca gcacgccgcg cgccatcgcg       180
     cgcaccctca accaggccgg cgtggcggtc tgggagccgg gcttcgtctg gatggcgcgc       240
     ctgtccgagc tggacaagca gatcaaggcc ggcggctacc aggccatcga cggcgactcg       300
     ccctggcagt tgctgcaacg gctggcgcgc ggcgacatga gccagcgcca gatcactttc       360
     ctggagggct ggatgttccg gcagatgcgc caggcgctgc gcgaacatcc cgacgtcaag       420
     cagaccctgg gcgagaccag cgacgaggcc ctgatggaaa ggctgggctc gacggtgacc       480
     catcccgagg gcatgttctt tcccgacacc tatgtgttca ctccgggcag cacggatttc       540
     gacatcctgc ggcgcgccta ccaggaaggg cagcgtatcc tggagtcgac ctgggccaag       600
     cgccaggatg ggctgccggt gggcacgccc tacgaagcgc tgatcctggc ctccatcgtc       660
     gagaaggaga ccggccacgg gccggagcgc gcgcgcgtgg ccggggtgtt cgccaaccgg       720
     ctgcgcatcg gcatgctgct gcagaccgat ccgaccgtga tctacggcat gggcgaggcc       780
     taccagggcc gtatccgcaa gcgcgacctg cagaccgaca cgccatggaa cacctacacc       840
     cgtccgggcc tgccgcccac gcccatcgcc gcgcccgggc gcgccgcgct gctggcggcg       900
     gtgcagcccg aacgccacaa atacctgttc ttcgtgtcgc gcggcaacgg caccagcgag       960
     ttctcggtca acctgaacga ccacaaccgc aatgtgtcgc gctacatatt gggacaaggg      1020
     caaccgcaac aaggatcgca gcaatga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page