(data stored in ACNUC1104 zone)

EMBL: BX640427.PE270

BX640427.PE270       Location/Qualifiers
FT   CDS_pept        272775..273554
FT                   /transl_table=11
FT                   /locus_tag="BPP1561"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1849"
FT                   /db_xref="GOA:Q7WA29"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA29"
FT                   /protein_id="CAE36863.1"
FT                   /translation="MVRMYVDSHCHLNFPELAQDLPAVLDRMAANQVTHALVVSVNMPD
FT                   WPGLMQLVEPHGNLWASVGVHPDYEDTPDPEPAELERLAAHPKVVAIGETGLDYYRLSE
FT                   PLDWQRERFRRHIRAARSTGLPLIVHTRASAQDTVRLLREEGADEVGGVMHCFTESWEI
FT                   AQQAMALNFHISLSGIVTFKNAQLVHEVAANMPLDRLLIETDSPYLAPVPYRGKLNDPS
FT                   KVIHVAEKIAELKGIPVAEVAHASTENFFKLFNKIKR"
     gtggtccgta tgtacgtaga ctcccattgt catctgaatt ttcccgaatt ggcgcaagac        60
     ctgccggccg tgctggatcg catggccgcc aaccaggtca cccatgcgct ggtcgtcagc       120
     gtcaacatgc ccgactggcc gggcctgatg caattggtcg agccgcacgg caatctctgg       180
     gcgtcggtgg gggtgcaccc cgactatgaa gacacgcccg atcccgagcc cgccgagctc       240
     gagcgcctgg ccgcgcaccc caaggtggtg gccatcggcg agaccgggct ggactactac       300
     cgcctgagcg agccgctgga ctggcagcgc gagcgctttc gccgccatat ccgcgcggcg       360
     cgctcgaccg gcctgccgct gatcgtgcat acgcgcgcct cggcgcagga cacggtgcgc       420
     ctgctgcgcg aagagggcgc cgacgaggtc ggcggcgtga tgcactgttt taccgagtcc       480
     tgggagatcg cccagcaggc catggcgctg aatttccata tctcgctttc gggcatcgtg       540
     acgttcaaga acgcgcagct cgtgcacgag gtggccgcca atatgccgct ggaccggctg       600
     ctgatcgaga ccgactcgcc ctacctggcg ccggtgccat atcgcggcaa gctgaacgat       660
     ccgtccaagg tgatccacgt ggccgagaag atcgccgagc tcaagggtat tccggtggcc       720
     gaggtggcgc atgcctctac cgagaatttc ttcaaacttt tcaataagat aaaacgataa       780
//

If you have problems or comments...

PBIL Back to PBIL home page