(data stored in ACNUC1104 zone)

EMBL: BX640427.PE271

BX640427.PE271       Location/Qualifiers
FT   CDS_pept        273605..274441
FT                   /transl_table=11
FT                   /locus_tag="BPP1562"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1850"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA28"
FT                   /protein_id="CAE36864.1"
FT                   /translation="MKPLRTRFLRWRGAAAGGLLAGALLASPAWAAKQADWWVYVHNDK
FT                   ARDIGALLAAGADPNVRYDNGQPAIMRAVVDNAWEVFDVLAANRRTDLNAENPAGETPL
FT                   MYLAVAGQTERAQALIARGAQVNRLGWTPLHYAASKGRLETARMLLGKQALVNAPSPDG
FT                   TTPLMMAAYSGDRRMVQLLLDAGADITTRNLKGMSAADWAAFGKSEALARELKPMIARA
FT                   EAERQARHGAVATPKLAPAAETPPTAQPAAAPAAASQPGEGRSLSGVSGVRLNSYD"
     atgaaaccct tgcgtacccg ttttctgcgc tggcgcggcg ccgcggccgg cggcctgctc        60
     gccggcgcct tgctggccag ccccgcctgg gcggccaagc aggccgactg gtgggtgtat       120
     gtccataacg acaaggcccg cgacatcggc gccttgctgg cggcgggcgc cgatcccaat       180
     gtgcgctacg acaatggcca gccggccatc atgcgggcgg tggtcgacaa cgcctgggag       240
     gtgttcgatg tgctggccgc caaccgccgc accgatctca acgccgagaa tcccgcgggc       300
     gagacgccct tgatgtacct ggcggtggcg gggcagaccg aacgcgcgca ggcgctgatc       360
     gcgcgcggcg cgcaggtcaa ccggctgggc tggacgccgc tgcactatgc ggcctcgaag       420
     ggccggctgg agaccgcgcg catgctgctg ggcaagcagg cgctggtcaa tgcgccgtca       480
     cccgacggca ccacgccgct gatgatggcc gcgtattcgg gcgatcgccg catggtgcag       540
     ttgttgctgg atgccggcgc cgatatcacc acgcgcaacc tcaagggcat gagcgcggcc       600
     gactgggccg ccttcggcaa gtccgaggcg ctggcgcgcg agctcaagcc catgatcgcc       660
     cgcgccgagg ccgaacggca ggcccgccat ggcgcagtgg ccacgcccaa gctggcgccg       720
     gccgccgaaa cgccgcccac ggcacagccc gcggcagccc ctgccgcggc gtcgcaaccc       780
     ggcgaaggcc gctccctgtc cggcgtctcg ggcgtgcggc tgaattccta cgattaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page