(data stored in ACNUC1104 zone)

EMBL: BX640427.PE279

BX640427.PE279       Location/Qualifiers
FT   CDS_pept        complement(281671..282918)
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="BPP1570"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1859"
FT                   /db_xref="GOA:Q7WA23"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA23"
FT                   /protein_id="CAE36872.1"
FT                   /translation="MSNNSPISIDGQRLWQSLMDLARIGATPKGGNCRLALTALDGQGR
FT                   DLVTGWMRDAGLTVRVDQVGNIFARRAGRDPSRAPVMTGSHIDTQPTGGKFDGCYGVLA
FT                   GLEVMRTLDDHGVQTDAPLEVAIWTNEEGSRFLPVMMGSGVFAGKFPLETALTARDAEG
FT                   KSVADELRAIGYAGADPVGGRAVDAYFEAHIEQGPILEHEDRIVGVVTGSLGVRWYDVV
FT                   VQGMEMHAGPTPMPIRKDALYAASHLLQAVVEIANAHQPHGRGTVGEIHAYPGSRNVIP
FT                   GQVRFTVDLRHEDEATLATMDALWRQACADTAARHAVSVQCEQVQYFAPTPFHPDLVGK
FT                   VRDGAQRRGLPAMDIVTGAGHDAVYMAAVAPTAMIFVPCKDGISHNEIEDAQPAHLEAG
FT                   CNVLLDAMVARANAPR"
     atgagcaaca actccccgat ctccatcgac ggacagcggc tgtggcagtc gctgatggac        60
     ctggcgcgca tcggcgccac gcccaagggc ggcaattgcc gcctggcgct gaccgcgctc       120
     gacggccagg gccgcgacct ggtcaccggc tggatgcgcg acgcgggcct gaccgtgcgc       180
     gtggaccagg tcggcaatat cttcgcgcgc cgcgccggac gcgatccgtc gcgcgcgccg       240
     gtcatgaccg gcagccacat cgacacccag cccaccggcg gcaagttcga cggctgctac       300
     ggcgtgctgg ccggactgga agtcatgcgc accctcgatg accacggcgt gcagaccgac       360
     gcgccgctgg aagtggcaat ctggacaaac gaggaaggct cgcgctttct gcccgtgatg       420
     atgggctcgg gcgtgttcgc cgggaaattc ccgctcgaga ccgcgctgac cgcgcgcgac       480
     gccgagggca agtcggtggc cgacgagctg cgcgccatcg gctatgccgg cgccgacccg       540
     gtgggcggac gcgcggtcga cgcctacttc gaggcgcaca tcgagcaagg ccccatcctg       600
     gaacacgaag acaggatcgt cggcgtggtg accggctcgc tgggcgtgcg ctggtacgac       660
     gtggtggtgc aaggcatgga gatgcatgcc ggccccaccc cgatgccgat ccgcaaggac       720
     gcgctgtacg cggccagcca tctgctgcag gcggtggtcg agatcgccaa cgcgcaccag       780
     ccgcacggcc gcggcacggt gggcgagatc cacgcctacc ccggttcgcg caacgtgatc       840
     cccggccagg tgcgcttcac ggtggacctg cgccacgagg acgaagccac gctcgccacg       900
     atggacgcgc tgtggcgcca ggcgtgcgcc gacaccgccg cgcggcatgc cgtatcggtg       960
     cagtgcgagc aggtgcagta cttcgcgccg acgcccttcc atcccgacct ggtcggcaag      1020
     gtgcgcgacg gcgcgcagcg ccgcggcctg ccggccatgg acatcgtgac cggcgccggc      1080
     cacgacgcgg tgtacatggc cgcggtcgcg cccacggcga tgatcttcgt gccctgcaag      1140
     gacggcatca gccacaacga gatcgaggac gcccagcccg cccacctgga ggccggctgc      1200
     aacgtgctgc tcgacgccat ggtggcgcgc gccaacgcgc cgcgctga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page