(data stored in ACNUC1104 zone)

EMBL: BX640427.PE28

BX640427.PE28        Location/Qualifiers
FT   CDS_pept        27692..28339
FT                   /transl_table=11
FT                   /locus_tag="BPP1319"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas fluorescens PhlH SWALL:Q9RF00
FT                   (EMBL:AF207529) (223 aa) fasta scores: E(): 5e-29, 43.75%
FT                   id in 208 aa, and to Rhizobium meliloti putative
FT                   transcriptional regulator, TetR family protein Rb0874 or
FT                   Smb21208 SWALL:Q92V43 (EMBL:AL603645) (225 aa) fasta
FT                   scores: E(): 6.7e-05, 25.11% id in 227 aa"
FT                   /db_xref="GOA:Q7WAQ3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ3"
FT                   /protein_id="CAE36621.1"
FT                   /translation="MTRPRRSLRADGASTRARILEAAGQLFGQYGYAGVASKAICAAAG
FT                   ADLAAINYHFGSRDGLYRAVLVEGHKHFINLDTLTALTQSDLSPREKLCAFIDGMVAGL
FT                   WEQDWHTRVCAREVLAPSAHFAALIDEEVLPKFRLVAGILGDITGFAPGDPALARCAVS
FT                   IVAPCMMLMVVDRNAPSPPQQVLAQPAADLAEHLKRFALAGLDAVSAAAPRR"
     atgaccagac cgcgccgttc gctgcgggcc gacggggcca gcacccgcgc caggatcctc        60
     gaggcagccg gccagctgtt cggccagtac ggctatgcgg gcgtggccag caaggccatt       120
     tgcgcggccg ccggcgccga cctggcggcg atcaactacc acttcggcag ccgcgacggc       180
     ctgtaccgcg cggtgctggt cgaggggcac aagcatttca tcaatctcga taccttgacg       240
     gcgctgacgc aaagcgatct gtcgccgcgc gagaaactgt gcgccttcat cgacggcatg       300
     gtggcggggt tgtgggagca ggactggcac acgcgggtct gcgcgcgcga ggtgctggcg       360
     ccgtcggcgc atttcgccgc gctgatcgac gaagaggtgc tgcccaagtt ccggctggtg       420
     gcgggcatcc tgggcgacat cacgggcttt gcgccgggcg atccggcgct ggcgcgttgc       480
     gccgtgagca tcgtggcgcc atgcatgatg ctgatggtgg tcgaccgcaa tgcgcccagc       540
     ccgccgcagc aggtgctggc gcagccggcg gccgacctgg ccgagcatct caagcgcttc       600
     gcgctggccg gcctggacgc ggtcagcgcc gccgcgccgc gccgctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page