(data stored in ACNUC1104 zone)

EMBL: BX640427.PE283

BX640427.PE283       Location/Qualifiers
FT   CDS_pept        complement(286879..287361)
FT                   /transl_table=11
FT                   /locus_tag="BPP1574"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1863"
FT                   /db_xref="GOA:Q7WA20"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA20"
FT                   /protein_id="CAE36876.1"
FT                   /translation="MLGRISHALSGLSKAIAALAVALLAALITYVVFERFVMHTTPHWA
FT                   EELPRLVLVWAAFIGGVTCSHERTHLMAGLLPFVVRNPRALAICDRVNQALIIVGLAAL
FT                   GYAGWQLAELTMDQTLPALDVSAGTVYLALPVACAITIVVHLAQLFQPADPVAAKD"
     atgctgggcc ggatctcgca cgcgctgtcc ggcctgagca aggccatcgc cgccctggcg        60
     gtggccttgc tggccgcact gatcacctac gttgtgttcg aacgcttcgt gatgcacacc       120
     acgccgcact gggccgagga attgccgcgc ctggtgctgg tgtgggcggc cttcatcggc       180
     ggcgtcacct gcagccatga acgcacccac ctgatggccg ggctgctgcc cttcgtcgtg       240
     cgcaacccgc gcgcgctggc catctgcgac cgcgtcaacc aggcattgat catcgtcggc       300
     ctggccgcgc tgggttatgc cggctggcag ctggccgaac tgaccatgga ccagaccctg       360
     cccgcgctcg acgtatcggc cggcacggtc tacctcgccc tgccggtggc gtgcgccatc       420
     accatcgtgg tgcacctggc gcaattgttc caaccggccg accccgtcgc ggcaaaggat       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page