(data stored in ACNUC1104 zone)

EMBL: BX640427.PE286

BX640427.PE286       Location/Qualifiers
FT   CDS_pept        complement(289355..289738)
FT                   /transl_table=11
FT                   /locus_tag="BPP1577"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1867"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA18"
FT                   /protein_id="CAE36879.1"
FT                   /translation="MKPAIHLKRAYEAAAPADGRRVLIDGLWPRGLRKDALPLDDWIKD
FT                   LAPSAALRQWFGHQTPRWPAFRERYLAELRGPSHQAQLRALLAQAGAGPLTLVYGARDT
FT                   EHNNAVVLREALLALAAGGRGAA"
     atgaagcccg ccatccatct caagcgcgcc tatgaggccg ccgcgcccgc cgacgggcgc        60
     cgggtgctga tcgacgggct gtggccgcgc ggcctgcgca aggacgccct gccgctggac       120
     gactggatca aggacctggc gcccagcgcg gcgctgcgcc agtggttcgg ccaccagacg       180
     ccccgctggc cggcgtttcg cgaacgctat ctggccgagc tgcgcggccc gtcgcatcag       240
     gcgcagctgc gcgccctgct ggcgcaggcc ggggccggcc cgcttacgct ggtctacggc       300
     gcgcgcgaca ccgagcacaa caacgcggtg gtgttgcgcg aggcgctgct ggcgctggcg       360
     gcgggcggac gcggcgcggc ctag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page