(data stored in ACNUC1104 zone)

EMBL: BX640427.PE288

BX640427.PE288       Location/Qualifiers
FT   CDS_pept        complement(290288..291985)
FT                   /transl_table=11
FT                   /locus_tag="BPP1579"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Salmonella typhi hypothetical membrane
FT                   protein YbjL or Sty0903 SWALL:Q8Z851 (EMBL:AL627268) (561
FT                   aa) fasta scores: E(): 3.7e-41, 31.81% id in 572 aa, and to
FT                   Yersinia pestis hypothetical membrane protein Ypo1326
FT                   SWALL:Q8ZGH1 (EMBL:AJ414147) (562 aa) fasta scores: E():
FT                   1.3e-41, 32.22% id in 571 aa"
FT                   /db_xref="GOA:Q7WA16"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA16"
FT                   /protein_id="CAE36881.1"
FT                   /translation="MQAFVQFLGSNPYILLFLTIGLAVWVGKFSIKGYGLGAVAAAIVV
FT                   GCLVATVGAAYGVKFHLDEFAKSLLYYLFMYGVGLRVGPSFVNALNKESINYAILAIIA
FT                   PILGLAIVVLGTQFFGLPLGAAGGMLAGSQTMSAAIGSAEQAVSAGVLSLGSESPEQIS
FT                   AMIALSYGITYIWGTVGIILLCKYLPRIWGVDAKAAALEFEKAHGVPNVDDAGLTAFHP
FT                   FDLRAYRVENPESIGKTVQQFRTRFPQYQVVNVERGDQLLGPSAETVLQQGDVVALGGR
FT                   LEEMTANMGMLGPEVPDARALNIPLDQAEILVTNKEVTGRPLKTFRGSELAGQIQLQRV
FT                   ERSGVPLPIGLETTLQKRDVLFVTGLQPAVSKAGEIFGVIARHSSATDLLTLSFGMILG
FT                   FLIGLIEVPAFGAKVGLGNAGGLLLSGIIVSSISSRLRFFGNTPNAARNILEDLGLIGF
FT                   VAIVGINAGADLLTQLTGAIALKIFIVGFLASTIPPIIVWAIGFHIMKINPALLMGATA
FT                   GARSHSGPAREAAKEVGSSVPWLGFPVGYAVSGVLLTVFGYFAMVLAH"
     atgcaggctt tcgtgcaatt cctgggcagc aacccctaca tactgctgtt tctcaccatc        60
     ggcctggcgg tctgggtcgg caagttttcc atcaagggct acgggctggg cgcggtcgcc       120
     gccgccatcg tggtcggctg cctggtcgcc accgtgggcg cggcctacgg cgtcaagttc       180
     cacctggacg agttcgccaa gtcgctgctc tattacctgt tcatgtacgg cgtggggctg       240
     cgcgtgggtc cgtccttcgt caacgcgctg aacaaggagt ccatcaacta cgccatcctg       300
     gccatcatcg cgccgatcct gggcctggcc atcgtggtgc tgggcacgca gttcttcggc       360
     ctgccgctgg gcgcggccgg cggcatgctg gccggctcgc agaccatgtc ggcggccatc       420
     ggctcggccg aacaggcggt cagcgccggc gtgctgtcgc tgggttcgga gagtcccgag       480
     cagatcagcg ccatgatcgc gctgtcctac ggcatcacct acatctgggg cacggtcggc       540
     atcatcctgc tgtgcaagta cctgccgcgc atctggggcg tggacgccaa ggccgccgcg       600
     ctcgagttcg agaaggcgca tggcgtgccc aacgtggacg acgccgggct gacggccttt       660
     catccgttcg acctgcgcgc ctaccgggtc gagaacccgg aatcgatcgg caagacggtc       720
     cagcagttcc gcacgcgctt tccccagtac caggtggtca atgtcgagcg cggcgaccag       780
     ctgctcggcc cctcggccga gaccgtgctg cagcagggcg acgtggtggc gctgggcggc       840
     cgcctggagg aaatgaccgc caacatgggg atgctcggcc ccgaggtgcc cgacgcccgc       900
     gcgctgaaca taccgctgga ccaggccgag atcctggtga ccaacaagga ggtgaccggc       960
     cggccgctga agaccttccg cggttcggag ctggccgggc agatccagct gcagcgcgtc      1020
     gagcgcagcg gcgtgccgct gcccatcggc ctggaaacca cgctgcaaaa gcgcgacgta      1080
     ctgttcgtga ccggcctgca gccggccgtc agcaaggccg gcgagatctt cggcgtgatt      1140
     gcgcgccata gctcggccac cgacctgctg accctgtcgt tcggcatgat cctgggcttt      1200
     ctgatcgggc tgatcgaagt gccggcgttc ggcgccaagg tggggctggg caacgcgggc      1260
     ggcctgctgc tgtcgggcat catcgtgtcg tcgatttcct cgcggctgcg ctttttcggc      1320
     aacaccccca acgccgcgcg caacatcctc gaggacctgg gcctgatcgg cttcgtggcc      1380
     atcgtcggca tcaacgccgg cgccgacctg ctcacccagc taaccggcgc gatcgcgctg      1440
     aagatcttca tcgtgggctt tctcgcctcg accatcccgc ccatcatcgt gtgggccatc      1500
     ggctttcaca tcatgaagat caaccccgcg ctgctgatgg gcgccaccgc cggcgcgcgc      1560
     agccactcgg ggccggcgcg cgaagccgcc aaggaagtcg gctccagcgt gccctggctg      1620
     ggattcccgg tcggctacgc cgtctccggc gtgctgctga ccgtgttcgg ctacttcgcc      1680
     atggtcctgg cgcactga                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page