(data stored in ACNUC1104 zone)

EMBL: BX640427.PE29

BX640427.PE29        Location/Qualifiers
FT   CDS_pept        28399..30159
FT                   /transl_table=11
FT                   /locus_tag="BPP1320"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ2"
FT                   /protein_id="CAE36622.1"
FT                   /translation="MAKEAYTVGPVLSFRGVGGARQWRVSALIGVPRTAKAPALRVEGR
FT                   ACAAPVVLHQTARETFLRYDLSCDMQARERKVEFGPRGGPAWHFTVPAKGAAPRLAYVS
FT                   CNGFSDPSGMRKLVRPENAVWADLLCNHDRDLRPADYLLDKEQLWHETRTHDEGLQRFH
FT                   LLLMGGDQIYFDSIWEYIAALKQWVGLARAQQLEFKVSQALEDEIEAYYFGLYSRRWLP
FT                   PSRAPWAGAQPSLDAADAMARVPTIMMWDDHDIFDGWGSYSPAMQRCELFQTLFRHARR
FT                   AFWVFQMQHALADLPPLQAIARANVLPQDPQYEGIAWSRQLKRDRLALPLLDGQPGFTS
FT                   AYRLGPLALVAADLRTERSRTQILGTQAWTALQGWLHGLKGNRPASATGGCRHLIFMSS
FT                   VPVAHLKLSLAEGLLDTFGQDHVLDSNADDLKDHWSHDDHEGERKRLLETLMQVANEKL
FT                   LRVSIASGDVHVAAWGNAYRRDIPPTSNWAQIQQFTSSAVVHPSLLGVAERLFLFMLNG
FT                   TAAQAQPIDVNLSVEMMLFPGHNRYVMPARNWLAFELDAGKAGKLWASWRCETETGFSN
FT                   HLQAVQPAQG"
     atggcaaaag aggcgtacac cgtcgggccc gtcttgtcgt ttcgcggcgt gggaggcgcg        60
     cgccagtggc gcgtgagcgc gctgatcggc gtcccgcgca ccgcgaaggc gcccgcgctg       120
     cgcgtggaag ggcgggcctg tgccgcgccc gtggtgctgc accagaccgc gcgcgaaacc       180
     ttcctgcgct acgacctcag ctgcgacatg caggcgcgcg agcgcaaggt cgagttcggc       240
     cccaggggcg gaccggcctg gcatttcacc gtgcccgcga agggcgccgc gccgcgcctg       300
     gcctatgtgt cgtgcaacgg cttttccgac cccagcggca tgcgcaagct ggtgcgcccg       360
     gaaaacgccg tatgggcgga cctgctgtgc aaccacgatc gcgacttgcg gccggcggac       420
     tatctgctgg acaaggaaca gttgtggcac gaaacgcgta cccatgacga aggcctgcag       480
     cgcttccacc tgctgctgat gggcggcgac cagatctatt tcgattcgat ctgggagtac       540
     atcgcggcgc tcaagcagtg ggtgggcctg gcgcgcgcgc agcagctgga attcaaggtc       600
     agccaggcgc tggaagacga gatcgaggcg tactacttcg gcctgtacag ccgccgctgg       660
     ctgccgccgt cgcgcgcgcc atgggcgggc gcgcagccca gcctggacgc cgccgacgcc       720
     atggcccgcg tgcccaccat catgatgtgg gacgaccacg acatcttcga cggctggggt       780
     tcgtacagcc cggccatgca gcgctgcgaa ctgttccaga ccctgttcag gcatgcgcgg       840
     cgcgccttct gggtcttcca gatgcagcac gcgctggccg acctgccgcc cctgcaggcg       900
     atcgcgcgcg ccaatgtgct gccgcaggat ccgcagtacg agggcatcgc ctggagccgg       960
     cagctcaagc gcgaccggct ggcgctgccg ctgctcgacg gccagcccgg cttcacctcg      1020
     gcctatcggc tggggccgct ggcgctggtg gccgccgacc tgcgcaccga gcgatcgcgc      1080
     acgcagatcc tgggcacgca ggcgtggacc gcgctgcagg gctggctgca tgggctcaag      1140
     ggcaaccggc cggcttcggc cacgggcggc tgccggcatc tgatcttcat gtcctcggtg      1200
     ccggtggcgc atctcaagct gtcgctggcc gaaggcctgc tcgacacctt tggccaggac      1260
     catgtgctcg acagcaatgc cgacgacctg aaagatcatt ggtcgcacga cgaccacgag      1320
     ggcgaacgca agcgcctgct ggagacgctg atgcaggtcg ccaacgagaa gctgctgcgc      1380
     gtgtcgatcg cctcgggcga cgtgcacgtg gcggcgtggg gcaatgccta ccggcgcgac      1440
     atcccgccca cgtcgaactg ggcgcagatc cagcagttca cctcgtcggc ggtggtgcac      1500
     ccgtcgctgc tcggcgtggc cgagcgcctg ttcctgttca tgctcaacgg cacggcggcc      1560
     caggcgcagc ccatcgacgt gaacctgagc gtggagatga tgctgtttcc tggccacaat      1620
     cgctatgtga tgccggcgcg caactggctg gccttcgagc tcgacgccgg caaggccggc      1680
     aagctgtggg cgagctggcg ctgcgagacc gagacgggct tctccaacca tctgcaggcg      1740
     gtgcagcccg cgcagggctg a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page