(data stored in ACNUC1104 zone)

EMBL: BX640427.PE290

BX640427.PE290       Location/Qualifiers
FT   CDS_pept        complement(293886..295619)
FT                   /transl_table=11
FT                   /locus_tag="BPP1582"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3465 SWALL:Q9HYE1 (EMBL:AE004767) (571 aa) fasta
FT                   scores: E(): 1e-126, 60.62% id in 574 aa, and to Rhizobium
FT                   meliloti putative transport transmembrane protein R00235 or
FT                   Smc02910 SWALL:Q92SW7 (EMBL:AL591783) (551 aa) fasta
FT                   scores: E(): 5.8e-68, 38.94% id in 529 aa"
FT                   /db_xref="GOA:Q7WA15"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA15"
FT                   /protein_id="CAE36883.1"
FT                   /translation="MLQAPASAPEDLPRASAEAAPPPSRPGVLAPFGYPAFRMIWIANL
FT                   FANLGIWAQSVAAAWIVTEAQSGPLIVAMIQVAAALPLVALSIVTGVVADNHDRRKVML
FT                   VGMGLELVVGTLITALAFLGLLHPVTLIVAVFVVSIGSAIVTPAWQAAVSEQVPRQYVG
FT                   NAVLLNSVNYNVARAIGPAIGGVLLGALGAPWVFLLNCFCYGALIWAIWRWRRETPPRT
FT                   LPPERIYEGVVAALRFTEYSNVTRLVMMRAFSFGLSASALWALLPVLAHEHDNGSASLY
FT                   GYMLGALGLGAIAGSLGIRTVQRRLGVSRLISVAAALLALGLIALGVTENLWVVFPALL
FT                   LSGSCWIAVLATYNATVQLLVPDWVKARALTLYQTAIFGGLALGSFIWGHFAGSMGTRG
FT                   AMAAAGVALLFTVALLYRSRLPDHVDDKCLSVLPRAALPAGQSDFDARHGVVLVSIEYR
FT                   IAAERARAFIDAAGPLRLMRMRNGADQWQLFRDLEDAERWSEMFVVDSWLQYLRMNDRM
FT                   TLADKMAIDAAQAFHSGPNPPQVTHAVSYISVSAAGGRGHAAPPAPAGPAQAAMGPVTA
FT                   D"
     atgctgcaag cccccgcctc cgcccccgaa gacctgccgc gcgccagcgc cgaagccgcc        60
     ccgccgccgt cccgccccgg ggtgctggcg ccgttcggct atccggcgtt ccgcatgatc       120
     tggatcgcca acctgttcgc caatctgggg atctgggccc agtcggtcgc cgcggcctgg       180
     atcgtgaccg aagcccagag cggcccgctc atcgtcgcca tgatccaggt ggccgccgcc       240
     ctgcccttgg tggccctgtc catcgtgacc ggcgtggtcg ccgacaacca cgaccggcgc       300
     aaggtgatgc tggtgggcat gggcctggag ctggtcgtcg gcaccctcat cacggcgctg       360
     gccttcctcg ggctgctgca cccggtcacc ctgatcgtgg cggtgttcgt ggtctccatc       420
     ggcagcgcca tcgtcacccc ggcctggcag gccgccgtca gcgagcaggt gccgcgccag       480
     tacgtaggca acgccgtcct gctcaacagc gtgaactaca acgtcgcgcg cgccatcggg       540
     ccggccatcg gcggcgtgct gctgggcgcc ctgggcgccc cctgggtctt cctgctgaac       600
     tgcttctgct atggcgcgct gatctgggcg atctggcgct ggcgccgcga aacgccgccg       660
     cgcaccctgc cgcccgagcg catctacgaa ggcgtggtgg cggcgctgcg ctttaccgag       720
     tactcgaacg tgacccgcct ggtcatgatg cgcgccttct cgttcggcct gtcggccagc       780
     gccctgtggg cgctgctgcc ggtgctggcg cacgaacacg acaacggcag cgcctcgctg       840
     tacggctaca tgctgggcgc cctcggcctg ggcgccatcg ccggcagcct cggcatccgc       900
     acggtgcagc ggcggctcgg cgtcagccgc ctgatcagcg tggccgccgc cttgctggcg       960
     ctgggcctga tcgccctggg cgtgaccgaa aacctgtggg tggtgttccc ggcgctgctg      1020
     ctgtccggct cgtgctggat cgccgtgctg gccacctaca acgccaccgt gcagctgctg      1080
     gtgccggact gggtcaaggc gcgcgcgctg acgctctacc agaccgccat tttcggcggg      1140
     ctggcgctgg gctcgttcat ctggggccac ttcgccggca gcatgggcac ccgcggggcg      1200
     atggcggcgg ccggcgtggc gctgctgttc accgtggcgc tgctgtaccg ctcgcggctg      1260
     cccgaccacg tcgacgacaa gtgcctctcg gtgctgccgc gggcggccct gcccgccgga      1320
     cagtcggact tcgacgcgcg ccatggcgtg gtgctggtct cgatcgagta ccgcatcgcc      1380
     gccgaacgcg cgcgcgcctt catcgacgcg gccggcccgc tgcggctgat gcgcatgcgc      1440
     aacggcgccg accaatggca attgttccgc gacctcgagg acgccgaacg ctggtcggag      1500
     atgttcgtgg tcgactcctg gctgcagtac ctgcgcatga acgaccgcat gacgctggcc      1560
     gacaagatgg ccatcgacgc ggcccaggcc tttcacagcg ggcccaaccc gccgcaggtc      1620
     acgcacgccg tcagctacat ctccgtcagc gccgcgggcg ggcgcggcca tgccgcgcca      1680
     ccggctccgg ccggccccgc gcaggccgcc atggggcccg taaccgcgga ttag            1734
//

If you have problems or comments...

PBIL Back to PBIL home page