(data stored in ACNUC1104 zone)

EMBL: BX640427.PE291

BX640427.PE291       Location/Qualifiers
FT   CDS_pept        295810..297354
FT                   /transl_table=11
FT                   /locus_tag="BPP1583"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transmembrane protein Rsp1524 or Rs04801 SWALL:Q8XPW2
FT                   (EMBL:AL646085) (505 aa) fasta scores: E(): 5.5e-61, 39.96%
FT                   id in 498 aa, and to Rhizobium loti two-component system
FT                   histidine protein kinase Mll4698 SWALL:Q98DH8
FT                   (EMBL:AP003004) (535 aa) fasta scores: E(): 7.2e-20, 28.91%
FT                   id in 505 aa"
FT                   /db_xref="GOA:Q7WA14"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA14"
FT                   /protein_id="CAE36884.1"
FT                   /translation="MALSRPARLLSRIGMVTALGIVAALGIVIAVASILAQDRQQVWER
FT                   EARSARNVLQALAGEFERTVTAYDLVIRGVIGDLAQPAVAAMGPEALHRLLFQQGARPD
FT                   NLAVLLVLDERGEVILDSRTAVVAPRNRSRRDYFQAHVDNPQAGLFISKPYRSRNRNGE
FT                   LSIALSRRLAHPDGSFAGVVVAAVSLSYFRDRVVQLNVGPRGSMTLFRDDGIVISRKPY
FT                   VEAQIGVDLSESANVSRFPREGRGAFVGTAILDGVERLYQFERVGKLPLIMVVALSTDD
FT                   MMTPWRRHAWVLAGAVLLLCALLVALLAALERELRRRRNAEAELAQLARIDTLSGLLNR
FT                   RAFAQVLALEWEAALRGRTPLALLLVDVDHFKAYYDCYGRSASDVLLRRVADAVRDCVP
FT                   YAANVVARHGADEFVVLLPGMGLRSAAWLAERVRARVLGLAVPHRGNRGGVVSVSIGCT
FT                   AMTPLAGSEAAVLVERADAALYLAKSRGRNRVERIGDPSTAGQGAEREMAQEPGGS"
     ttggcgcttt cccggcctgc acgcttactg agccgtatcg gcatggtgac cgcactgggc        60
     atcgtggcgg cgctcggcat cgtgatcgca gtggcatcca tcctggccca ggaccggcaa       120
     caggtctggg agcgcgaagc ccgttcggcc cgcaatgtgc tgcaggcgct ggccggcgaa       180
     ttcgagcgca cggtgacggc ctacgacctg gtcatccgcg gcgtcatcgg cgacctggcc       240
     cagccggcgg tggcggcgat ggggcccgag gcgctgcatc gcctgctgtt ccagcagggc       300
     gcgcggcccg acaacctggc ggtcctgctg gtgctcgacg agcgcggcga ggtgatcctg       360
     gattcgcgca cggccgtcgt tgcaccccgc aaccgctcca ggcgcgatta cttccaggcg       420
     catgtcgaca acccgcaggc cggcctgttc atcagcaagc cctatcgcag ccgcaaccgc       480
     aacggcgagc tgagcatcgc gctgagccgc cgcctcgcgc atccggacgg cagcttcgcc       540
     ggcgtggtgg tggccgcggt cagcctgtcg tatttccgcg accgcgtggt ccagctgaac       600
     gtgggaccgc gcggctcgat gaccctgttc cgcgacgacg gcatcgtcat cagccgcaag       660
     ccgtacgtgg aggcgcagat cggcgtggac ctgagcgagt ccgccaacgt gagccggttc       720
     ccgcgcgagg gcaggggcgc cttcgtcggc accgccatcc tggacggggt ggaacggctc       780
     taccagttcg agcgggtggg caagctgccg ctgatcatgg tggtggcgct gtccaccgac       840
     gacatgatga cgccatggcg ccgccacgcc tgggtgctgg ccggcgccgt gctgctgctg       900
     tgcgcgttgc tggtggcgct gctggcggcg ctcgagcgcg agttgcgcag gcgccgcaac       960
     gccgaggccg agctggcgca actggcgcgc atcgacaccc tcagcggact gctcaaccgg      1020
     cgcgccttcg cgcaggtgct ggcgctggag tgggaggccg cgctgcgcgg ccgcacgccg      1080
     ctggcgctgc tgctggtcga tgtggaccac ttcaaggcct actacgactg ttatggccgt      1140
     tcggccagcg atgtgctgtt gcggcgcgtc gccgatgcgg tgcgcgattg cgtgccctat      1200
     gccgccaatg tggtggcgcg ccacggcgcc gacgaattcg tggtgctgct gcccggcatg      1260
     gggttgcgca gcgccgcgtg gctggccgag cgggtgcgcg cccgcgtgct ggggctggcc      1320
     gtgccgcacc gcggcaaccg gggcggcgtg gtctcggtca gcatcggctg cacggccatg      1380
     acgccgctgg ccggcagcga ggccgcggtg ctggtcgaac gcgccgatgc ggcgctgtac      1440
     ctggccaagt cgcgcggccg caaccgggtc gagcgcatcg gcgacccgag caccgcgggg      1500
     cagggggcgg agcgcgaaat ggcgcaggag ccgggcggct cctag                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page