(data stored in ACNUC1104 zone)

EMBL: BX640427.PE294

BX640427.PE294       Location/Qualifiers
FT   CDS_pept        298895..299614
FT                   /transl_table=11
FT                   /locus_tag="BPP1586"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1170 SWALL:Q9I4G7 (EMBL:AE004547) (244 aa) fasta
FT                   scores: E(): 2.3e-41, 52.54% id in 236 aa, and to Ralstonia
FT                   solanacearum hypothetical transmembrane protein Rsc0556 or
FT                   Rs04909 SWALL:Q8Y1Y1 (EMBL:AL646060) (232 aa) fasta scores:
FT                   E(): 1.7e-33, 48.85% id in 219 aa"
FT                   /db_xref="GOA:Q7WA11"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA11"
FT                   /protein_id="CAE36887.1"
FT                   /translation="MLEFFQTLSWAAVFQIILIDILLGGDNAVVIALACRNLEPKQRMQ
FT                   GILWGTAGAIGLRVVLIAFALTLLTVPYLKIVGALLLWVGVKLLIPEDDAHGNIKGGTS
FT                   IAAAVKTIIIADFVMSLDNVIAIAGAAQGAAQEHQLGLVIFGLVVSVPIIIWGSTLVLK
FT                   LIDRFPMVVTFGAALLGWIAGGMLVTDVVVVERFGEVSGVAKIAAEVAGALLIVGLGRW
FT                   FARRKAAAAPQTARESA"
     gtgcttgagt ttttccagac cctgagctgg gccgccgtat tccagatcat cctgatcgac        60
     atcctgctgg gcggcgacaa cgcggtcgtg atcgcgctgg cgtgccgcaa cctggagccc       120
     aagcagcgca tgcagggcat tctgtggggc acggccggcg ccatcggctt gcgggtcgtg       180
     ctgatcgcct tcgcgctgac gctgctgacg gtgccttacc tgaagatcgt gggcgcgctg       240
     ctgctgtggg tgggcgtgaa gctgctgatc cccgaggatg acgcgcatgg caacatcaag       300
     ggcggcacgt ccatcgccgc cgcggtcaag accatcatca tcgccgactt cgtgatgagc       360
     ctggacaacg tcattgcgat cgccggcgcg gcgcagggcg cggcgcagga gcatcagctg       420
     ggcctggtga tcttcggcct ggtggtcagc gtgcccatca tcatctgggg cagcacgctg       480
     gtgctcaagc tgatcgaccg cttcccgatg gtcgtcacct tcggcgcggc gctgctgggc       540
     tggatcgccg gcggcatgct ggtcaccgac gtggtggtgg tcgagcgctt cggcgaagtc       600
     tcgggcgtcg cgaagatcgc cgccgaggtg gcgggcgcgc tgctgatcgt gggcctgggc       660
     cgctggttcg cccgtcgcaa ggccgcggcc gcgccgcaga ccgcgcgcga aagcgcctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page