(data stored in ACNUC1104 zone)

EMBL: BX640427.PE296

BX640427.PE296       Location/Qualifiers
FT   CDS_pept        301318..301827
FT                   /transl_table=11
FT                   /locus_tag="BPP1588"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium leguminosarum hypothetical 14.7
FT                   kDa protein SWALL:Q9AE37 (EMBL:AJ310723) (135 aa) fasta
FT                   scores: E(): 0.0057, 28.82% id in 111 aa, and to Rhizobium
FT                   meliloti hypothetical protein R02424 or Smc01516
FT                   SWALL:Q92N19 (EMBL:AL591790) (137 aa) fasta scores: E():
FT                   0.0024, 33.67% id in 98 aa"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA09"
FT                   /protein_id="CAE36889.1"
FT                   /translation="MVLRGALVAQTSALAWAREDRAALEASLPGLPRRRVLARRLDFLM
FT                   ERVQSLLRARSGGTPGPALMVDASAKSVLCVGAGGAAARAARAAIERAGGRFLHHDGEV
FT                   GDAAGLEASLVSADLVICQTGCVSHGAYWRVQDHCKRTGKQCVLVEQPAALNIVRVRRP
FT                   ADAPQD"
     atggtgctgc gcggcgcgct ggtggcgcag accagcgccc tggcctgggc ccgcgaggac        60
     cgcgctgccc tggaggcgtc cctgccgggc ctgccgcgtc gccgcgttct ggcgcgccgc       120
     ctcgacttcc tgatggaacg ggtgcaaagc ctgctgcgcg cgcgttccgg tggcacgccc       180
     gggcccgcgc tgatggtcga tgccagcgcg aagtcggtgc tgtgcgtcgg cgcgggcggg       240
     gccgccgcgc gggccgcgcg cgcagccatc gagcgcgccg gcggccgctt tctgcatcac       300
     gacggcgaag tcggcgatgc cgccgggctg gaagccagcc tggtatcggc cgacctggtc       360
     atctgccaga ccggctgcgt cagccacggc gcgtactggc gcgtgcagga ccactgcaag       420
     cgcacgggca agcaatgcgt gctggtcgag cagccggccg ccctgaacat cgtgcgggtg       480
     cgcaggcccg ccgacgcgcc gcaggactga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page