(data stored in ACNUC1104 zone)

EMBL: BX640427.PE297

BX640427.PE297       Location/Qualifiers
FT   CDS_pept        301954..302745
FT                   /transl_table=11
FT                   /locus_tag="BPP1589"
FT                   /product="putative transmembrane regulator"
FT                   /note="Similar to Pseudomonas fluorescens transmembrane
FT                   regulator PrtR SWALL:Q9KIN0 (EMBL:AF228766) (242 aa) fasta
FT                   scores: E(): 0.0013, 31.12% id in 241 aa, and to Rhizobium
FT                   loti hypothetical protein Mlr0408 SWALL:Q98MW6
FT                   (EMBL:AP002994) (257 aa) fasta scores: E(): 2.1e-21, 39.04%
FT                   id in 251 aa"
FT                   /db_xref="GOA:Q7WA08"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA08"
FT                   /protein_id="CAE36890.1"
FT                   /translation="MKGGPADPIADVELDAYIDGQLDSARRADVEAFLARDARAAARVS
FT                   ADLRLRDALRQGATRHGAGARDAHTRALADRLQAAHARRRVARRARRLLAVAILVAAGW
FT                   AGHAALTAWTPAEPAGDAGVQVFLDEAMRAHRTAQLRAGMRSQPAAPRLDRAELARQAG
FT                   VPLPAWPWDWLPRDVQVFPSRGGPAVEVALLAGRAGPISLYGAPGGAGPDSAPRMARGA
FT                   GAEALFWWRRGAWVYAVIGALPEAALRPLAQRLADAPLVHE"
     gtgaagggcg gacccgcgga ccccatcgcg gatgtcgagc tggacgccta catcgacggc        60
     cagctcgata gcgcgcggcg cgccgacgtc gaggccttcc tggcgcgcga cgcgcgcgcg       120
     gcggcgcgcg taagcgccga cctgcgcctg cgcgatgccc tgcggcaagg cgccacgcgc       180
     catggcgccg gcgcgcgcga cgcgcatacg cgggccctgg ccgaccgcct gcaggcggcc       240
     cacgcccggc ggcgggtcgc gcgccgcgcc cggcgcctgc tggcggtggc gatcctggtg       300
     gccgcgggtt gggcgggaca tgcggccctg acggcctgga cgccggccga gccggccggc       360
     gacgccggcg tgcaggtgtt cctggacgag gcgatgcgcg cgcatcgtac ggcgcagttg       420
     cgcgccggca tgcgctcgca gcccgccgcg ccgcgcctgg accgcgccga actggcgcgc       480
     caggccggcg tgccgctgcc ggcctggccg tgggattggc tgccgcgcga tgtgcaggtc       540
     tttccgtcgc gcggcgggcc agccgtggag gtggcgctgc tggccgggcg cgcgggcccg       600
     atctcgctgt atggcgcgcc aggcggggca ggccccgaca gcgcgccgcg gatggcgcgc       660
     ggcgcgggcg ccgaggcctt gttctggtgg cggcgcggcg cttgggtcta tgcggtgatc       720
     ggcgcgttgc cggaggcggc gctgcggccg ctggcgcagc ggctggccga cgcccctctg       780
     gtgcacgagt ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page