(data stored in ACNUC1104 zone)

EMBL: BX640427.PE298

BX640427.PE298       Location/Qualifiers
FT   CDS_pept        302939..303376
FT                   /transl_table=11
FT                   /locus_tag="BPP1590"
FT                   /product="putative universal stress protein"
FT                   /note="Similar to Brucella melitensis universal stress
FT                   protein family Bmeii0245 SWALL:Q8YDD2 (EMBL:AE009663) (148
FT                   aa) fasta scores: E(): 3.2e-18, 46.3% id in 149 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein Atu0496 or
FT                   Agr_c_878 SWALL:Q8UI04 (EMBL:AE009019) (160 aa) fasta
FT                   scores: E(): 9.1e-19, 48.96% id in 145 aa"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA07"
FT                   /protein_id="CAE36891.1"
FT                   /translation="MYQHILIPIDGSDLANTAIDKGLALAKALGARVTVLTVVEPYPHM
FT                   AAEAVQLGGLRKEYEKQVHARASEWLEPAGAKAAAAGVPCELLKRDADMAFRAIVETAA
FT                   ERGCDLIAMASHGRGGVAAVLLGSQTQKVLAHSQVPVLVYR"
     atgtatcaac acatcctcat tcccatcgat ggctctgacc tggccaatac ggcgatcgac        60
     aagggcctgg cgctcgcgaa agcgctgggc gcccgcgtca cggtgctgac ggtggtcgag       120
     ccctatccgc acatggccgc cgaggccgtg cagctgggcg gcctgcgcaa ggaatacgaa       180
     aagcaggtcc atgcgcgcgc cagcgaatgg ctggagcccg cgggggccaa ggccgcggcc       240
     gcgggagtgc cgtgcgagct gctcaagcgc gacgccgaca tggcgtttcg cgccatcgtg       300
     gagacggcgg ccgaacgggg ctgtgacctg atcgccatgg cctcgcacgg gcgcggcggc       360
     gtggccgcgg tgctgctggg cagccagacg cagaaggtgc tggcgcattc gcaggtgccg       420
     gtgctggtgt accgctag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page