(data stored in ACNUC1104 zone)

EMBL: BX640427.PE301

BX640427.PE301       Location/Qualifiers
FT   CDS_pept        complement(304884..305603)
FT                   /transl_table=11
FT                   /locus_tag="BPP1593"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1174"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA04"
FT                   /protein_id="CAE36894.1"
FT                   /translation="MGRRARRPGSGRRFFGHGGYDPRHGDLIRLPLHFYKFPAAELPGA
FT                   RPGPTLYRLASEHAMEIAALTWSTPLARLAPVPPRTSAAPPSHDWPHAAPSVRPHGAAG
FT                   PAAAPADLLRDLHAQARMARAVAAYQAEQAARQTAARSPCAAQGLGDIDCLMVLQAYRV
FT                   AMPMRRCRTCRECRPRRNAAARPWARSRGPALPISKYVDKSGSYRQKLRNNLKKRDAAC
FT                   KQPTVAAIWPRRGCAAP"
     atgggccggc gcgcgcgccg gcccgggtct ggacggaggt tcttcggtca tgggggatat        60
     gacccccggc atggcgattt aatccgcctg cctctgcact tttacaaatt tcccgccgcg       120
     gaacttccgg gcgcccggcc cggaccaacc ctgtaccgcc tggcctcgga gcacgccatg       180
     gaaatcgccg ccctcacctg gtctacgccc ctggcgcgcc tcgcgccggt gccgccgcgc       240
     acctcggccg cgccgccgtc gcacgactgg ccccacgcgg cgccgtccgt ccggccgcac       300
     ggcgccgccg gccccgcggc ggcgccggcg gacctgctgc gcgacctgca cgcccaggcg       360
     cgcatggcgc gcgccgtggc cgcttaccag gcggaacagg ccgccaggca gacggcggcg       420
     cgctcgccgt gcgccgccca gggcctcggc gacatcgatt gcctgatggt gctgcaggcc       480
     taccgggtgg ccatgcccat gcgccggtgc aggacctgca gggaatgccg cccgcggcgc       540
     aacgcggcag cccggccgtg ggcccgatcg cgcggaccgg ccctgccgat cagcaaatac       600
     gtagataaat caggcagcta caggcaaaaa ttaaggaata atcttaagaa gcgagacgct       660
     gcctgtaagc agccgaccgt tgcggctatt tggccgcgcc gaggatgcgc agcgccttga       720
//

If you have problems or comments...

PBIL Back to PBIL home page