(data stored in ACNUC1104 zone)

EMBL: BX640427.PE302

BX640427.PE302       Location/Qualifiers
FT   CDS_pept        305672..307264
FT                   /transl_table=11
FT                   /locus_tag="BPP1594"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1172"
FT                   /db_xref="GOA:Q7WA03"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA03"
FT                   /protein_id="CAE36895.1"
FT                   /translation="MPMPFEWMTDPTAWLGLATLIVLEIVLGIDNLVFIAILADKLPAH
FT                   QRNRARMIGLTLALLMRLGLLASIAWVVTLTAPLFTVWGAQISGRDLILILGGLFLLFK
FT                   GTMELHERVEGNAHAGGGGRTQYAAFWQVIVQIVALDAVFSLDSVITAVGMVQDLSIMM
FT                   TAVVVAMIVMMVASRPLMAFVARHPTVVILCLGLLLMIGFSLVAEGLGFDVPKGYLYAA
FT                   IGFSILVEACNQLARRNLARGAHALGRRQRAAHAVLRLLQAGREGRAHPEEVAALVADT
FT                   GEGPLFAPEESTMIERVLAMGERDVRSIMVPRADMVWLDVRDPRHVVLEKFALGHARLP
FT                   LCAGDPGNVLGVVHLRDLLPRLSAPGPVDLVDAARPAAYVSETTPIPQLLQQMRDLRQH
FT                   LLLVVDEHGVCVGLATPLDVLTAVAGELPDAGDADPPSASRLPDGGWSLDGRLAVEEVA
FT                   RLLQAPDLRRDYPDATLAGCLLRASGAIPEEGQGMDWRQWRFEVERRVGPRIERVRATR
FT                   RVEALADELAGPA"
     atgccgatgc cgttcgaatg gatgaccgac cccactgcct ggctggggct ggcgaccctg        60
     atcgtgctgg agatcgtgct gggcatcgac aacctggtgt tcatcgccat cctggccgac       120
     aagctgcccg cgcaccagcg caaccgcgcg cgcatgatag gcctgacgct ggccttgctg       180
     atgcggctgg gcctgctggc cagcatcgcc tgggtggtga cgctgaccgc gccgctgttc       240
     acggtgtggg gcgcgcagat atccggccgc gacctgatcc tcatcctggg cgggctgttc       300
     ctgctgttca agggcaccat ggagctgcac gaacgcgtcg agggcaacgc gcacgcgggc       360
     ggcggcgggc gtacgcagta cgccgcgttc tggcaggtga tcgtgcagat cgtggcgctg       420
     gacgcagtgt tctcgctcga ttcggtgatt accgccgtgg gcatggtgca ggacctgagc       480
     atcatgatga ccgccgtggt ggtggcgatg atcgtgatga tggtggccag ccggccgctg       540
     atggccttcg tggctcgcca tccgaccgtg gtgatcctgt gcctgggcct gctgctgatg       600
     atcgggttca gcctggtcgc agaaggcctg ggtttcgacg tgcccaaggg ctatctgtac       660
     gcggcgatcg gcttttccat cctggtcgag gcctgcaatc agctggcgcg gcgcaacctg       720
     gcgcgcggcg cccatgcgct gggccggcgc cagcgcgccg cgcacgcggt gctgcgcctg       780
     ctgcaggccg gccgcgaggg acgggcccat cccgaggaag tcgccgcgct ggtggccgat       840
     acgggcgagg ggccgctgtt cgcgccggag gaaagcacca tgatcgagcg ggtgctggcg       900
     atgggcgagc gcgatgtgcg ctcgatcatg gtgccgcgcg ccgacatggt gtggctggac       960
     gtgcgcgatc cgcgccacgt ggtgctggag aaattcgccc tgggccatgc gcgcctgccc      1020
     ttgtgcgccg gcgacccggg caatgtgctg ggcgtggtgc atctgcgcga cctgctgccg      1080
     cggctgtccg cgccggggcc ggtcgacctg gtcgacgcgg cgcgtccggc cgcctacgtg      1140
     agcgagacca cgccgatccc gcaattgctg cagcagatgc gcgacctgcg ccagcatctg      1200
     ctgctggtgg tcgatgagca cggggtgtgc gtgggcctgg ccacgccgct ggacgtcctg      1260
     acggcggtgg ccggcgaact gcccgatgcc ggcgacgccg acccgccgag cgccagccgc      1320
     ttgcccgacg gcggctggtc gctggatggg cggctggcgg tcgaggaagt ggcgcgcctg      1380
     ctgcaggcgc cggacctgcg gcgcgactat ccggacgcga cgctggccgg gtgcctgctg      1440
     cgcgccagcg gcgccatccc cgaggaaggc cagggcatgg attggcggca gtggcgcttc      1500
     gaggtcgagc gccgcgtcgg gccgcgcatc gagcgggtgc gcgccacgcg ccgcgtcgaa      1560
     gcgctggccg acgaactggc cggcccggcg tag                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page