(data stored in ACNUC1104 zone)

EMBL: BX640427.PE303

BX640427.PE303       Location/Qualifiers
FT   CDS_pept        complement(307279..307857)
FT                   /transl_table=11
FT                   /locus_tag="BPP1595"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1171"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA02"
FT                   /protein_id="CAE36896.1"
FT                   /translation="MSLIEIRKRTLIVETTYHENGPAPAQPLKLAASCAVIRNPYAGRY
FT                   EPDLMPFMAELRSLGTLLATELVDTLGKDNIEVYSKAAIVGVDGEMEHGAVWHEAGGWA
FT                   MRSVLGEPKAMVPAVKAVATAGYRMMVPVHYIHASYVRSHFNSIEIGIQDAPRPREILF
FT                   ALVMGTGARVHARLGGLTKEAVSVHDGQR"
     atgtctttga tcgaaatccg caagcgcacg ctcatcgtcg aaaccaccta tcacgagaac        60
     ggcccggcgc cggcgcagcc gctcaagctg gcggcctcct gcgccgtgat ccgcaatccc       120
     tacgcgggcc gctacgagcc cgacctgatg ccgttcatgg ccgagctgcg ctcactgggc       180
     accctgctcg ccaccgagct ggtcgacacg ctgggcaagg acaacatcga ggtctacagc       240
     aaagccgcca tcgtgggcgt ggacggcgaa atggagcacg gcgcggtctg gcacgaagcc       300
     ggcggctggg cgatgcgcag cgtgctgggc gaacccaagg ccatggtccc ggcggtcaag       360
     gccgtggcca cggccggcta tcgcatgatg gtgccggtgc actacatcca tgcctcgtac       420
     gtgcgcagcc atttcaacag catcgagatc ggcatccagg acgccccgcg tccgcgcgaa       480
     atcctgttcg cgctggtcat gggcaccggg gcacgcgtgc acgcgcgcct gggcggcctg       540
     accaaggaag ccgtctcggt gcacgacggc cagcgctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page