(data stored in ACNUC1104 zone)

EMBL: BX640427.PE304

BX640427.PE304       Location/Qualifiers
FT   CDS_pept        complement(307882..308835)
FT                   /transl_table=11
FT                   /locus_tag="BPP1596"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1170"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA01"
FT                   /protein_id="CAE36897.1"
FT                   /translation="MFKPLFATAALALAIGQATAAYPERPIRMVVPFPPGSITDVVARS
FT                   LGQGMAAELGQPVVVENKPGANGIIGTQDVVKAQPDGYTLVVVGVSTAASGVSLFKNLP
FT                   YDPARDLTPIGAVAETPYLLVGGQDVAGKTVADLYDYGRQHPDKLTYAYGSGSAQVFGA
FT                   KLAAMGDITVTPVPYRGGPQALTDVIGGTVDLTFTDLANGLQQARAGKVKVYGVSTPGR
FT                   FALTPDIPTLNESGAPGFDLTVWFGLMGPAGLPPAVTERLAGALDKALAAPELTQTYAR
FT                   QGLSVKTQGPAAFGAFVRSEIEKWAGIVKETGIAPQ"
     atgttcaagc ccctgttcgc cacggcggcg ctggcgctgg ccatcggcca ggccacggcc        60
     gcctatcccg aacgcccgat ccgcatggtg gtgccgtttc cccccggcag cattaccgac       120
     gtcgtggcgc gcagcctcgg ccagggcatg gccgccgaac tcggccagcc cgtcgtggtc       180
     gagaacaagc ccggcgccaa cggcatcatc ggcacccagg acgtggtcaa ggcgcaaccc       240
     gacggctaca cgctggtggt ggtcggcgta tcgaccgcgg ccagcggcgt cagcctgttc       300
     aagaacctgc cctacgaccc ggcgcgcgac ctcacgccca tcggcgcggt ggccgaaacg       360
     ccgtacctgc tggtgggcgg gcaggatgtc gcgggcaaga cggtggccga cctgtatgac       420
     tacggccgcc agcacccgga caagctgacc tacgcctacg gctcgggcag cgcccaggtg       480
     ttcggcgcca agctggccgc catgggcgac atcactgtca cgcccgtgcc ctatcgcggc       540
     ggcccgcagg cgctcaccga tgtgatcggc ggcacggtgg acctgacctt caccgacctg       600
     gccaacggcc tgcagcaggc gcgcgccggc aaggtcaagg tgtacggcgt cagcacgccc       660
     gggcgcttcg cgctgacgcc cgacattccc acgctcaacg aaagcggcgc gccaggcttc       720
     gacctgaccg tctggttcgg cctgatggga cccgccggcc tgccgcccgc ggtcaccgag       780
     cgcctggccg gcgcgctgga caaggcgctg gccgcgcccg agttgacgca gacctacgcg       840
     cgccagggcc tgagcgtgaa aacgcaaggc cccgccgcct tcggcgcctt cgtgcgcagc       900
     gaaatcgaaa aatgggccgg catcgtcaag gaaaccggca ttgcgcccca gtaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page