(data stored in ACNUC1104 zone)

EMBL: BX640427.PE309

BX640427.PE309       Location/Qualifiers
FT   CDS_pept        complement(312938..313060)
FT                   /transl_table=11
FT                   /locus_tag="BPP1601"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1165A"
FT                   /db_xref="GOA:Q7W9Z7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z7"
FT                   /protein_id="CAE36902.1"
FT                   /translation="MLLTLYFLAWPVVSAAVLLVLIVTLWRDIRDARATGKSMI"
     atgctattga cgctttactt cctggcctgg cccgtcgttt cggctgccgt cctgctggtg        60
     ctgatcgtca ccctgtggcg tgacatccgc gacgcgcgcg ccaccggcaa gtccatgatc       120
     tag                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page