(data stored in ACNUC1104 zone)

EMBL: BX640427.PE311

BX640427.PE311       Location/Qualifiers
FT   CDS_pept        complement(315221..316666)
FT                   /transl_table=11
FT                   /locus_tag="BPP1603"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1164"
FT                   /db_xref="GOA:Q7W9Z5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z5"
FT                   /protein_id="CAE36904.1"
FT                   /translation="MPPSRHLPPITALLSFRLNQLAQAGAGLPHPTRAIAVAAILINVF
FT                   MATLESAIANTALPAIAADLGVSEASSIWVISAYHLAMVAALLPIASLGEIIGHRRISM
FT                   AGLVLFTLASLACGLAPSLPWLIAGRLAQGVGAAGILGVALAMTRFVYPREQLGCGLGL
FT                   NALVVSLSLAAGPTAASLILSLGSWHWLFLINVPLGLALGVCALPPTPRSARRYDAVAG
FT                   LLCALFLALLVYTLNAYAHDVGAGGNTAYALATLAMLALLLRRQSGRGAPMLATDLLRR
FT                   PIFALSAAATLGAFAAQTLAFVALPFMLQSLLGYTQVQTGFLITPWPALAALSAASAGA
FT                   LSDRHPPGLLGGIGMAVLAAGLLSLVALPAAPDAFDLGWRMALCGAGFGFFQAPNMRAM
FT                   LADAPPERSGGASGMTSSSIMLGQSLGAALVAGLFTLRGAAAAPAALWLGVAFAVIAGI
FT                   ASLLRLRHAAAAGAGARLDLTRV"
     atgccgccgt cccgccacct ccctccgata accgctttgc tcagtttcag actcaaccag        60
     cttgcgcagg ccggtgccgg cctgccgcac ccgacccgcg ccatcgccgt cgcggccatc       120
     ctgatcaacg tcttcatggc gacgctcgaa tcggccatcg ccaacacggc gctgccggcc       180
     atcgccgccg acctgggcgt aagcgaagcc agttcgatct gggtcatcag cgcctaccac       240
     ctggccatgg tggcggcgct gctgcccatc gcgtcgctgg gcgagatcat cggccatcgc       300
     cgcatttcca tggccggcct ggtgctgttc accctggcct ccctggcgtg cggcctggcg       360
     ccttcgctgc cgtggctgat cgccggacgg ctggcgcagg gcgtgggcgc ggccggcatc       420
     ctgggcgtgg cgctggccat gacgcgcttt gtctatccgc gcgaacagct cgggtgcggc       480
     ctgggcctga acgcgctggt cgtcagcctg tcgctggcgg ccggccccac tgcggcctcg       540
     ctgatcctca gcctgggcag ctggcactgg ctgttcctga tcaacgtgcc gctgggcctg       600
     gcgctgggcg tatgcgcgct gccgcccacc ccgcgcagcg cacgccgcta cgatgccgtc       660
     gcgggcctgc tgtgcgcgct gttcctggcc ttgctggtct atacgctcaa tgcctacgcg       720
     cacgatgtcg gcgccggcgg caacaccgcc tacgcgcttg ccacgctggc aatgctggcg       780
     ctgctgctca ggcgccaatc gggccgcggc gcgcccatgc tggccaccga cctgctgcgc       840
     cgccccatct tcgcgctgtc ggccgccgcc acgctgggcg ctttcgcggc ccagacgctg       900
     gccttcgtcg ccctgccctt catgctgcaa agcctgctgg gctacaccca ggtgcagacc       960
     ggcttcctga tcacgccctg gcctgcgctg gccgcgctga gcgcggccag cgcaggcgcg      1020
     ctgtcggacc gccatccgcc cggcctgctc ggcggcatcg gcatggccgt gctggccgcg      1080
     ggcctgctgt cgctggtggc gttgccggcc gcgccggacg ccttcgacct gggctggcgc      1140
     atggcgctgt gcggggccgg cttcggcttc ttccaggcgc ccaacatgcg cgccatgctg      1200
     gccgatgcgc cgcccgaacg cagcggcggc gccagcggca tgaccagctc cagcatcatg      1260
     ctgggccagt cgctgggcgc ggcgctggtg gccggcctgt tcaccctgcg cggcgcggcc      1320
     gcagcgcccg ccgcgctatg gctgggcgtg gccttcgccg tcatcgcggg catcgccagc      1380
     ctgctgcgtt tgcgccatgc cgcagccgcc ggcgccggcg cgcggctgga cctgacgcgc      1440
     gtttga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page