(data stored in ACNUC1104 zone)

EMBL: BX640427.PE321

BX640427.PE321       Location/Qualifiers
FT   CDS_pept        325703..327361
FT                   /transl_table=11
FT                   /locus_tag="BPP1613"
FT                   /product="probable methyl-accepting chemotaxis protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   methyl-accepting chemotaxis transducer transmembrane
FT                   protein Rsp0255 or Rs03711 SWALL:Q8XT60 (EMBL:AL646077)
FT                   (529 aa) fasta scores: E(): 1.7e-67, 44.15% id in 530 aa,
FT                   and to Yersinia pestis putative methyl-accepting chemotaxis
FT                   protein Ypo1644 SWALL:Q8ZFP9 (EMBL:AJ414149) (526 aa) fasta
FT                   scores: E(): 1.4e-56, 40.78% id in 532 aa"
FT                   /db_xref="GOA:Q7W9Y6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y6"
FT                   /protein_id="CAE36914.1"
FT                   /translation="MRRNLPVTGHEFVLQDDQYLISKTDLKGRITYCNPAFIAISGFSR
FT                   EELLGQPHNIVRHPDMPEDVFADMWATLQARKPWLAVVKNRHKSGGFYWVLANAMPVIE
FT                   AGNVTGYASVRVKATQAQIEAAEHFYAQVESGRMGGHGLRHGQRVPRGWRRAARALAFP
FT                   LRKGVRPALLRLAAAMCGLAAIPTYFAIGAMPPEAAPYGWGAYALGALGAVLAAMALGG
FT                   RFGRQLRNAEEVARQIAAGNLVNEVDSGVGGEMRNLYFYLDIMRKSLIGISTEVIGKTS
FT                   EHVHTISRLREDSQGLAARTEAQSAALQDTASSVEQLAETVTRNAESAGVAARLTQESS
FT                   EVAAQGGAVVGELVATMQGLDASSRKMAEIVSVIEGIAFQTNILALNAAVEAARAGEQG
FT                   KGFAVVAAEVRSLAQRTAQAAKEVKVLIDDSVGRMSTGSAQAGRAGETMRELVQSVERV
FT                   TALMAEISTASGEQSTGVAQISSAVHRMEEVVQQNVSMVGELTHVAEHLGQESGSLVEA
FT                   IGVFRTPGAGARAIGMPEQAPRRAPARTLLLAEHP"
     atgcgcagga atttgcccgt caccgggcac gagttcgtat tgcaggatga ccagtatctc        60
     atttccaaga cggacttgaa ggggcgcatc acctactgca acccggcctt tatcgccatc       120
     agcggattct cgcgcgaaga gctgctgggc cagccgcata acatcgttcg ccacccggac       180
     atgcccgaag acgtgttcgc ggacatgtgg gccacgctgc aggcgcgcaa gccctggctg       240
     gcggtggtga agaaccggca caagtccggc ggcttctact gggtgctcgc caacgcgatg       300
     cccgtgatcg aggcgggcaa cgtgacgggc tatgcctcgg tgcgggtcaa ggccacgcag       360
     gcgcagatcg aggccgccga gcacttctat gcccaggtgg aaagcggccg gatgggcggc       420
     catggattgc gccacggtca acgcgtgccg cgcggctggc ggcgcgccgc ccgcgcgctg       480
     gcgtttccgt tgcgcaaggg cgtgcggcct gccttgctgc ggctggcggc cgccatgtgc       540
     ggcctggcgg ccattcccac ctacttcgcc atcggcgcca tgccgccgga ggccgcgccg       600
     tatggctggg gcgcctatgc gctgggtgcg ctgggcgcgg tgctggccgc gatggcgctg       660
     ggcggccggt tcggcaggca actgcgcaat gccgaggagg tggcgcgcca gatcgcggcc       720
     ggcaacctgg tcaacgaggt ggactcgggc gtcggcggcg agatgcgcaa tctctatttc       780
     tacctggaca tcatgcgcaa gagcctgatc ggcatctcca ccgaggtcat cggcaagacg       840
     tccgagcatg tgcataccat ctcgcgcctg cgcgaggaca gccagggcct ggccgcgcgc       900
     accgaggcgc agtcggcggc gctgcaggac accgccagca gcgtggagca actggccgag       960
     acagtcaccc gcaacgccga aagcgccggg gtggcggccc ggctgaccca ggaaagcagc      1020
     gaggtggccg cgcaaggcgg cgccgtggtc ggcgaactgg tggcgaccat gcaggggctg      1080
     gacgcgagtt cgcgcaagat ggccgagatc gtatccgtga tcgaagggat tgccttccag      1140
     accaatatcc tggcgctgaa cgccgccgtc gaggcggcgc gggccggcga gcagggcaag      1200
     ggcttcgcgg tcgtcgcggc cgaggtccgc agcctggcgc agcgcaccgc tcaggccgcc      1260
     aaggaagtca aagtgctgat cgacgattcg gtggggcgca tgtccaccgg ctcggcccag      1320
     gcgggccggg cgggcgagac gatgcgcgag ctggtgcagt cggtcgagcg cgtgaccgcc      1380
     ttgatggccg agatttccac cgcctcgggc gagcaatcga ccggcgtggc gcagatcagt      1440
     tccgccgtgc accgcatgga ggaggtggtg cagcagaacg tctccatggt gggcgaactg      1500
     acccacgtcg ccgagcacct gggccaggag tcggggtcgc tggtcgaggc catcggcgta      1560
     ttccgcaccc ccggcgcggg cgcgcgcgcg atcggcatgc cggagcaggc gccacggcgc      1620
     gcgcctgcgc gcaccctgtt gctggccgag cacccctga                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page