(data stored in ACNUC1104 zone)

EMBL: BX640427.PE323

BX640427.PE323       Location/Qualifiers
FT   CDS_pept        329205..330176
FT                   /transl_table=11
FT                   /locus_tag="BPP1615"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative membrane
FT                   transport protein Sc8f11.16C SWALL:Q9KZG2 (EMBL:AL353864)
FT                   (325 aa) fasta scores: E(): 6.2e-07, 30.03% id in 293 aa,
FT                   and to Pseudomonas aeruginosa probable Mfs transporter
FT                   Pa2701 SWALL:Q9I0E1 (EMBL:AE004698) (529 aa) fasta scores:
FT                   E(): 0.0055, 34.35% id in 195 aa"
FT                   /db_xref="GOA:Q7W9Y4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y4"
FT                   /protein_id="CAE36916.1"
FT                   /translation="MQRLQASLERRQVGIYFAAMALGAVLAWHRPGLQVGEATLNLMLA
FT                   GMLLATFMQVPLAGWRATLPGMRFLGVLLSVNFVLVPALVWGLAALLPADPMIRLAVLL
FT                   VLLAPCIDYVVTFAQLGRADARALLAATPVLLCGQMLLLPLYLNVMLGSDAAALIRPGP
FT                   FVQAFVWLIALPLAAATGVQWAAARSAAWRGAASVVGLLPVPATALVLATIVAAVAPRM
FT                   ALAGEAVSRVVPVYLLFAVIAPAAGWLAARRARLAAPQARAVAFSAGTRNSLVVLPLAL
FT                   AVPGGVPLLPALIVAQTLVELCAELLYVRVFGRAGKDRAGEG"
     atgcagcgct tgcaggcgtc gctcgaacga cggcaggtcg gtatctattt cgcggcgatg        60
     gcgctgggcg ccgtgctggc ctggcaccgg cccggcctgc aggtgggcga ggccacgctc       120
     aatctcatgc tggccggcat gctgttggcg accttcatgc aggtgccgct ggccggctgg       180
     cgcgccacgc tgcccggcat gcggttcctg ggggtgctgc tgagcgtgaa cttcgtgctc       240
     gtgccggccc tggtctgggg cctggccgcg ctgttgccgg ccgaccccat gatccgcctg       300
     gcggtcctgc tggtgctgct cgcgccctgc atcgattatg tcgtgacgtt cgcgcaattg       360
     ggccgtgccg acgcccgggc cctgctggcg gccactccgg tgctgctgtg cgggcagatg       420
     ctgctgctgc cgctctactt gaacgtcatg ctgggcagcg atgccgccgc gctgattcgt       480
     cccggtccgt tcgtgcaggc ctttgtctgg ctgattgcct tgccattggc ggctgcaacg       540
     ggcgtgcagt gggcggccgc gcggtcggca gcctggcgcg gcgcggccag cgtggtcggc       600
     ctgttgccgg tgccagcgac cgcgctggtg ctggcgacca tcgtggccgc tgtcgcaccg       660
     cgcatggcgc tggccggcga ggccgtatcg cgggtcgtcc cggtgtatct gctgttcgcc       720
     gtcattgcgc cggccgcggg ctggctggcc gcgcgccgcg cccgtctggc ggcgccacag       780
     gcgcgcgcgg tcgcgttcag cgccggtacg cgcaattcgc tggtggtgct gccgctggcc       840
     ctggcggtgc ccggcggtgt gccgctgttg cccgcgctga tcgtggcgca gacgctggtc       900
     gaactgtgcg ccgagctgct ctatgtccgg gtgtttggcc gggcgggcaa ggaccgcgcc       960
     ggcgagggct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page