(data stored in ACNUC1104 zone)

EMBL: BX640427.PE324

BX640427.PE324       Location/Qualifiers
FT   CDS_pept        complement(330189..330494)
FT                   /transl_table=11
FT                   /locus_tag="BPP1616"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y3"
FT                   /protein_id="CAE36917.1"
FT                   /translation="MPAKDVPYQSMNLLCAILPEGNTSNRVGRRLADLLVQDAQGRLYR
FT                   VERHRIEGGHPDLVCGIDYIYCRLAGGGVVRCIDEQTYELPDGTVAHVVPDSTLRS"
     atgcctgcaa aagacgttcc ataccaatct atgaacctgc tgtgcgccat tcttcccgaa        60
     ggcaacacca gcaaccgcgt cggccggcgc ctggccgacc tgctggtgca ggacgcccaa       120
     ggcaggctgt atcgcgtcga gcgccatcgc atcgaaggcg gccatccgga tctggtctgc       180
     ggcatcgact acatctattg ccggctggcc ggcggcggcg tggtgcgctg tatcgacgag       240
     cagacctacg aattgccgga cggcacggtc gcacacgtgg tgcccgacag cacgctgcgg       300
     tcctga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page