(data stored in ACNUC1104 zone)

EMBL: BX640427.PE327

BX640427.PE327       Location/Qualifiers
FT   CDS_pept        335145..335366
FT                   /transl_table=11
FT                   /locus_tag="BPP1619"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0892"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y0"
FT                   /protein_id="CAE36920.1"
FT                   /translation="MGDVMQRGELAHWLNVVAENGEPGAPQIPVPEQFVTALTTLRCIE
FT                   RNAQGQLVVTEKGRLALHMEEPGALHRQ"
     gtgggtgacg tgatgcagcg aggcgaattg gcacattggt tgaacgtcgt ggccgagaac        60
     ggcgagccgg gcgcgccgca gataccggtg ccggagcagt tcgtgacggc attgaccacg       120
     ctgcgctgca tcgaacgcaa tgcacaaggc caactggttg taaccgaaaa ggggcgcctg       180
     gccttgcata tggaggagcc tggggccctg catcgccaat aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page