(data stored in ACNUC1104 zone)

EMBL: BX640427.PE328

BX640427.PE328       Location/Qualifiers
FT   CDS_pept        335499..335738
FT                   /transl_table=11
FT                   /locus_tag="BPP1620"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0893"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X9"
FT                   /protein_id="CAE36921.1"
FT                   /translation="MQVTDWEGAMQHRDQEVLIDVSTAAMDTGGYGVLLTVTAEGGTEV
FT                   DAAFSYLGTCASLDEARDRAEAFAQDWLRENIYR"
     ttgcaagtaa cggactggga gggcgccatg cagcatcgtg accaggaagt actgatcgac        60
     gtttcgacgg ccgccatgga tactggcggg tacggcgtgc tgttgacggt gactgccgaa       120
     ggcggcaccg aagtcgatgc agcgttttct tatcttggaa cctgcgcctc gctggatgag       180
     gcgcgcgatc gggcggaggc gttcgcgcag gattggctgc gcgagaacat ctaccgctga       240
//

If you have problems or comments...

PBIL Back to PBIL home page