(data stored in ACNUC1104 zone)

EMBL: BX640427.PE33

BX640427.PE33        Location/Qualifiers
FT   CDS_pept        complement(34907..35557)
FT                   /transl_table=11
FT                   /locus_tag="BPP1324"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2156"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP8"
FT                   /protein_id="CAE36626.1"
FT                   /translation="MDSSQVPNPVLVLVGSPRRDGNSALLAQAVAEGARQSGAVATLLF
FT                   LDDYIAGFLTDEKEADARRPDDRYGELFFDHFLPARAVVLCTPVYWYGMSAQAKAFFDR
FT                   SFTYYSASHPRHAEVLRRMTGKRLALAVSSEETYPGAALGIVHQLQEFTRYTHSQFVGM
FT                   VHGAGNRRGEVAHDPRRPLQAAHRLGHGLLSLPYSDYRIDSPRDHQVWPGAPA"
     atggattcat ctcaagtccc caaccccgtg ctggtgctgg tcggcagtcc gcgccgcgac        60
     ggcaacagcg ccctgctcgc ccaggccgtg gccgagggcg cgcgccagtc cggcgccgtc       120
     gccacgctgc tgtttctcga cgactacatc gcgggcttcc tgaccgacga gaaagaggcc       180
     gatgcgcggc gccccgacga ccgctacggc gaactcttct tcgaccactt cctgcccgcg       240
     cgcgccgtgg tgctctgcac gccggtgtac tggtacggca tgtcggccca ggccaaggcc       300
     ttcttcgacc gctctttcac ctattactca gccagccatc cccgccacgc cgaggtactg       360
     cggcgcatga cgggcaagcg gctggcgctg gccgtgtcct ccgaggaaac ctaccctggc       420
     gcggccctgg gcatcgtgca tcagttgcag gagttcacgc gttacaccca ctcgcagttc       480
     gtcggcatgg tgcacggggc gggcaaccgc agaggcgaag tggcgcacga tccgcgccgt       540
     ccgctgcaag ccgcgcaccg gctgggccac ggcctgttgt cgctgcccta ctccgactat       600
     cgcatcgaca gcccgcgcga ccaccaggtc tggcccggcg cgccggcgtg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page