(data stored in ACNUC1104 zone)

EMBL: BX640427.PE331

BX640427.PE331       Location/Qualifiers
FT   CDS_pept        337482..337733
FT                   /transl_table=11
FT                   /locus_tag="BPP1623"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0896"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X6"
FT                   /protein_id="CAE36924.1"
FT                   /translation="MVQKVLNGFAVVAFATQPEHGMPPRAFIQTAPMDGAGQAEPQVFE
FT                   IFLARRFRSAVEAMSAARNALDRVVSVDQDGVPAPLPD"
     atggttcaga aggtcctcaa cggtttcgcc gtcgtggcgt tcgccaccca gcccgagcac        60
     ggcatgccgc cgcgcgcgtt catccagacc gcgcccatgg acggggccgg gcaggccgag       120
     ccgcaggtgt tcgagatttt cctggcgcgg cgctttcgca gcgcggtgga ggccatgtcg       180
     gcggcgcgca acgcgctgga tcgggtggta tcggtagacc aggacggcgt accggcgccg       240
     ctgccggact ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page