(data stored in ACNUC1104 zone)

EMBL: BX640427.PE333

BX640427.PE333       Location/Qualifiers
FT   CDS_pept        complement(338181..339998)
FT                   /transl_table=11
FT                   /locus_tag="BPP1625"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0899"
FT                   /db_xref="GOA:Q7W9X4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X4"
FT                   /protein_id="CAE36926.1"
FT                   /translation="MMPSPSPTPAGRNSLDTLRTLAPFLWPADRPGLKARVVIAILCLL
FT                   AAKAAVVYVPILYKSAVDQLGGGAPGAVTVPLGLILAYSAARVLSLLFSELRDAVFARV
FT                   GQHAIRAVGLQIFRHLHALALRFHLARQTGGLTRAIERGTKGIQTLLTFLLFNVLPTLF
FT                   EIGLVCAVLWKMFDGWLALATGATVTLYLAYTLVVTEWRTRFRRQMNETDSEANTKAVE
FT                   SLLNYETVKYFGNEEHEAQRYDASLRRYERAAVRSQVSLSILNIGQAVIISAGLTLVMW
FT                   MAARGIAQGRYTLGDFVLVNTYLLQLYDPLSFFGFIYREIKQALIDMERMFELLGEGRE
FT                   IADPPGALALRLEGGAVEFRDVYFGYDPRRPILKGVSFRIPAGKTVAVVGTSGAGKSTL
FT                   ARLLFRFYDADRGAILVDGQDVRGVTQASLRAAIGVVPEDTVLFNDTIHYNIAYGRPGA
FT                   SDGEVQAAARLAHIHDLIMAMPDGYRTMVGERGLKLSGGEKQRVAIARTLLKNPSIFLF
FT                   DEATSALDTHTEREIQANLREVSQGRSTLIIAHRLSTIADADEIIVLGDGRVVERGRHQ
FT                   ALLAQGGIYAGMWARQQEATRPAAVALDD"
     ttgatgccct ccccctctcc gacgcctgcc gggcgtaaca gcctggacac cttgcgcacg        60
     ctggcgccct ttctctggcc cgccgaccgc cccggcctga aggcccgggt cgtcatcgcc       120
     attctgtgcc tgttggcggc caaggcggcc gtcgtctatg tacctattct ttacaagtcg       180
     gcggtcgacc agctcggcgg cggcgcgccc ggcgccgtca cggtgccgct ggggctgatc       240
     ctggcctaca gcgccgcacg ggtgctgtcg ctgctgtttt ccgagctgcg cgacgccgtg       300
     ttcgcccgcg tcggccagca cgccatccgc gcggtgggcc tgcagatctt ccggcacctg       360
     cacgcgctgg cgctgcgctt tcacctggcg cgccagaccg gcggcctgac gcgcgccatc       420
     gagcgcggca ccaagggcat ccagaccctg ctgaccttcc tgctgttcaa cgtgctgccc       480
     acgctgttcg aaatcggcct ggtctgtgcg gtgctgtgga aaatgttcga cggctggctt       540
     gccctggcca ccggcgcgac ggtcaccctg tacctggcct acacgctggt ggtcacggaa       600
     tggcgcacgc gctttcgccg ccagatgaac gagaccgact ccgaggccaa taccaaggcg       660
     gtcgaaagcc tgctgaacta cgagaccgtc aagtatttcg gcaacgaaga gcacgaggcg       720
     caacgctacg acgcctcgct gcgccgctac gaacgcgccg cggtacgcag ccaggtcagc       780
     ctgtccattc tcaacatcgg ccaggccgtg atcatctcgg ccggcctgac gctggtcatg       840
     tggatggccg cccgcggcat cgcgcagggg cgctacaccc tgggcgattt cgtgctggtc       900
     aatacctatc tgctgcagct gtacgatccg ctcagcttct tcggcttcat ctaccgcgaa       960
     atcaagcagg ccctcatcga catggagcgc atgttcgaac tgctcggcga agggcgcgag      1020
     atcgccgacc cgcccggcgc gctcgccctg cggctggaag gcggcgcggt ggaattccgc      1080
     gacgtgtatt tcggctacga cccgcgccgc cccatactca agggcgtcag tttccgcatc      1140
     ccggccggca agaccgtggc cgtggtcggc acctcagggg ccggcaagtc gacgctggcg      1200
     cgcctgctgt ttcgcttcta cgatgccgac cgtggcgcca tcctggtcga cggccaggac      1260
     gtgcgcggcg tgacccaggc cagcctgcgc gcggccatcg gcgtcgtgcc ggaggacacc      1320
     gtcctgttca acgacaccat ccactacaac atcgcctatg gccggcccgg cgcgagcgac      1380
     ggcgaagtcc aggcggcggc gcggctggcc cacatccatg acctgatcat ggccatgccc      1440
     gacggctacc gcaccatggt gggcgaacgc ggcctgaaac tgtcgggcgg cgaaaagcag      1500
     cgcgtggcca tcgcccgcac gctgctcaag aacccatcca tcttcctgtt cgacgaagcg      1560
     accagcgccc tggacacgca taccgaacgc gaaatccagg ccaacctgcg cgaggtcagc      1620
     cagggccgct ccaccctgat catcgcccat cgcctctcca ccattgccga cgccgatgaa      1680
     atcatcgtgc tgggcgatgg ccgcgtggtc gagcgcggcc gccaccaggc actgctggcc      1740
     cagggcggca tctacgccgg catgtgggcg cgccagcagg aagccacccg tccggccgcc      1800
     gtggccctgg acgattga                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page