(data stored in ACNUC1104 zone)

EMBL: BX640427.PE336

BX640427.PE336       Location/Qualifiers
FT   CDS_pept        complement(341995..342207)
FT                   /transl_table=11
FT                   /locus_tag="BPP1628"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0902"
FT                   /db_xref="GOA:Q7W9X1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X1"
FT                   /protein_id="CAE36929.1"
FT                   /translation="MTPRQHFYFVWGMPIVLGALSVFGLLAALLGTGVWHWASWLALAW
FT                   LLVVIARFWIVPRERRPAPGPRRGG"
     atgacgccgc gccagcattt ctatttcgtc tggggcatgc ccatcgtgct gggcgcgctc        60
     agcgtgttcg ggctgctcgc cgccctgctg ggcaccggcg tgtggcactg ggcctcgtgg       120
     ctggcgctgg cctggctgct ggtggtgatc gcgcgcttct ggatcgtccc gcgcgaacgc       180
     cgtcccgcgc ccggcccgcg ccgcggcggc tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page