(data stored in ACNUC1104 zone)

EMBL: BX640427.PE35

BX640427.PE35        Location/Qualifiers
FT   CDS_pept        36592..37887
FT                   /transl_table=11
FT                   /locus_tag="BPP1326"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2153"
FT                   /db_xref="GOA:Q7WAP7"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP7"
FT                   /protein_id="CAE36628.1"
FT                   /translation="MSAPADPRLAQLRRMQRWALALLAAMIAGFVASHLMGGQGAWAWV
FT                   RAFCEAATVGALADWFAVVALFRRPLGLPIPHTAIIPANKARIGDNLAVFVRDHFLDPA
FT                   TLLEKLRVFDPAARLGHWLADPRQTRSLGQGARQVALQALDLLDEQAVSRAIQGFAVAQ
FT                   LRRWDAARTAGEVLALLTRDGRHQELLDAALRRLGDYLGEEDIRQRACALLVKFARKEW
FT                   PRIIAAVDVIGSVEGIADNLADRMARALVDELRDVLSRPDHPVRRNYEAWVADYIARLR
FT                   DDPELAGQVEALKQRLIDDPRVQEYALGLWRDIHAVLRRDLQAEDSALARHLEDALQAL
FT                   GQRLSRDPELRRAVNEHVLDSARKLTDSLRSGVTEHISRTVKNWDERHLVRELELSVGR
FT                   DLQYIRFNGTLVGGLIGLALHAGVLLVQRAGG"
     atgagcgcgc cggccgatcc gcgcctggcg caattgcgcc gcatgcagcg ttgggcgctg        60
     gcgctgctgg cggccatgat cgccggcttc gtcgccagcc acctgatggg cggacagggc       120
     gcctgggcct gggtacgggc gttctgcgag gccgccacgg tcggcgcgct ggccgactgg       180
     tttgccgtgg tggcgctgtt tcgccgcccg ctggggctgc cgattcccca taccgccatc       240
     atcccggcca acaaggcgcg tatcggcgac aaccttgcgg tgttcgtgcg cgatcatttc       300
     ctcgatcccg cgacgctgct ggaaaagctg cgcgtgttcg atccggccgc gcgcctgggc       360
     cattggctgg ccgacccgcg ccagacccgc agcctgggcc agggcgcgcg ccaggtggcg       420
     ctgcaggcgc tggacctgct cgatgagcag gctgtcagcc gcgccatcca gggcttcgcc       480
     gtggcgcagt tgcgccgctg ggacgcggcg cgcacggccg gcgaagtgct ggcgctcctg       540
     acccgcgacg gccgccacca ggaattgctg gacgccgcgc tgcgccggct gggcgactac       600
     ctcggcgaag aggatatccg ccagcgcgcc tgcgcgctgc tggtgaagtt cgcccgcaag       660
     gaatggccgc gcatcatcgc cgcggtggat gtcatcggct cggtggaggg cattgccgac       720
     aacctggccg atcgcatggc gcgcgccctg gtcgacgaac tgcgcgatgt gctgtctcgc       780
     ccggatcatc ccgtgcggcg caactacgag gcgtgggtgg ccgactatat tgcgcggctg       840
     cgcgacgacc ccgagctggc cggccaggtc gaggccctga agcagcgcct gatcgacgac       900
     ccgcgcgtac aggagtacgc gctggggcta tggcgcgaca tccatgcggt attgcggcgc       960
     gacctgcagg ccgaggattc ggcgctggcg cgtcacctgg aggatgccct gcaggcgctg      1020
     ggccaacggc tgtcgcgcga ccccgagctg cgccgggcgg tcaacgagca tgtgctggac      1080
     agcgcgcgca agctgaccga cagcctgcgc agcggcgtga ccgagcatat ctcgcgtacc      1140
     gtcaagaact gggacgagcg ccacctggtg cgcgaactcg aactgagcgt gggccgtgac      1200
     ctgcagtaca tccgcttcaa cgggacgctg gtgggcgggt tgatcggcct ggccctgcat      1260
     gccggcgtgc tgctggtgca gcgggccggc ggctga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page