(data stored in ACNUC1104 zone)

EMBL: BX640427.PE40

BX640427.PE40        Location/Qualifiers
FT   CDS_pept        complement(41389..41568)
FT                   /transl_table=11
FT                   /locus_tag="BPP1331"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2148"
FT                   /db_xref="InterPro:IPR021553"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP3"
FT                   /protein_id="CAE36633.1"
FT                   /translation="MPAKSKAQQMAAGAALAAKRGESRVSDLKGASRDMYDSMSERELE
FT                   HMAGTARKGKPYHK"
     atgccagcca aatccaaagc ccagcaaatg gccgccggcg cggcgctcgc ggccaagcgc        60
     ggcgaatcca gggtgagcga cctcaagggc gcctcgcgcg acatgtacga ctcgatgagc       120
     gagcgcgagc tcgaacacat ggccggcacc gcccgcaagg gcaagccgta ccataagtga       180
//

If you have problems or comments...

PBIL Back to PBIL home page