(data stored in ACNUC1104 zone)

EMBL: BX640427.PE42

BX640427.PE42        Location/Qualifiers
FT   CDS_pept        complement(42201..43037)
FT                   /transl_table=11
FT                   /locus_tag="BPP1333"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2146"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP1"
FT                   /protein_id="CAE36635.1"
FT                   /translation="MTPPARSSAAVPAQYADVHYADRPMRIEYALLAPERRDAPLLVFL
FT                   HEGLGSLAMWRDWPRRVCDAAGCRGLVYSRYGYGRSTVRPLDESRPIDYLHQQAAQALP
FT                   ALFAALGIDARRDKPVLFGHSDGASIALLYAALCPDAVAGIAVAAPHIYVEDITVANIA
FT                   VALRAYRETTLRDRLARYHDDVDSTFASWTDTWLDPAFRQWNIEAYLPAITCPMLAMQG
FT                   VDDEYGTLEQIRGIRRLAPQTRLLEIQDCGHSPHKDQPELVTRALAGFVGALPRPA"
     atgacgccgc ccgcccgctc ttccgccgcc gtgcccgcgc aatacgccga cgtgcattac        60
     gccgaccgtc ccatgcgcat cgagtatgcg ctgctcgcgc ctgagcggcg cgatgcgccc       120
     ctgctggtat tcctgcacga agggctgggg tcgctggcca tgtggcgcga ctggccgcgg       180
     cgcgtctgcg atgcggccgg atgccgcggg ctggtctatt cgcgctacgg ctacggccgc       240
     tcgaccgtcc gtccgctgga tgagagccgg cccatcgact acctgcacca gcaggccgcg       300
     caagccctgc ccgcgctgtt cgcggcgctg ggcatcgatg cgcggcgcga caagccggtc       360
     ctgttcggcc acagcgacgg cgccagcatc gcgctgctct atgccgcctt gtgcccggac       420
     gccgtggccg gaatcgcggt agccgcgccg catatctacg tcgaggacat taccgtcgcc       480
     aacatcgcgg tggcgctgcg cgcctaccgc gaaaccacgc tgcgcgaccg cctggcccgc       540
     taccacgacg atgtcgattc gaccttcgca tcgtggaccg acacctggct ggacccggcc       600
     ttccggcaat ggaacatcga ggcctacctg ccggccatca cctgcccgat gctggccatg       660
     cagggcgtgg acgacgaata cggcacgctg gagcagatcc gcggcatccg ccgcctggcg       720
     ccgcagaccc gcctgctgga aatccaggac tgcggccact cgccgcacaa ggaccagccc       780
     gagctggtga cgcgcgcgct ggccggattc gtgggcgcgc tgccgcgccc ggcgtaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page