(data stored in ACNUC1104 zone)

EMBL: BX640427.PE48

BX640427.PE48        Location/Qualifiers
FT   CDS_pept        47382..48311
FT                   /transl_table=11
FT                   /locus_tag="BPP1339"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2140"
FT                   /db_xref="GOA:Q7WAN5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN5"
FT                   /protein_id="CAE36641.1"
FT                   /translation="MNQPSSLAADLRGAWHAQAQSHPLITLGLAASAAGVVLLLVAGIV
FT                   NALTGENRVHVGYAVLGGTAGFAATALGALMALGLRAISARTQDAMLGFAAGMMLAASA
FT                   FSLILPGLDAAGTIVGPGPAAAAVVALGLGLGVLLMLGLDYFTPHEHERTGHQGPEAAR
FT                   VNRVWLFVLTIILHNLPEGMAIGVSFATGDLRIGLPLTSAIAIQDVPEGLAVALALRAV
FT                   GLPIGRAVLVAVASGLMEPLGALVGVGISSGFALAYPISMGLAAGAMIFVVSHEVIPET
FT                   HRNGHETTATVGLMAGFALMMFLDTALG"
     atgaatcaac cctcgtcgct tgccgccgac ctgcgcggcg cctggcacgc gcaggcgcag        60
     tcgcatcccc tgatcaccct cggattggcc gcctcggccg ccggcgtggt cttgctgctg       120
     gtggcgggca tcgtcaacgc gctgaccggc gagaaccgcg tccacgtggg ctacgcggtg       180
     ctgggcggca cggcgggctt cgccgccacg gcgctgggcg cgctgatggc cctggggctg       240
     cgcgcgatct cggcccgcac gcaggacgcg atgctgggtt ttgccgccgg catgatgctg       300
     gcggccagcg cgttctcgct gatcctgccc ggcctggacg cggccgggac catcgtgggc       360
     ccggggccgg ccgccgcggc ggtagtggcg ctgggcctgg ggctgggcgt gctgctgatg       420
     ctgggcctgg actacttcac gccgcacgag cacgaacgca ccggccacca ggggcccgag       480
     gcggcgcgcg tcaatcgcgt ctggctgttc gtgctgacca tcatcctgca caacctgccc       540
     gagggcatgg ccatcggcgt cagcttcgcc accggcgatc tgcgcatcgg cctgccgctg       600
     acctccgcca ttgccatcca ggacgtcccc gaagggctgg cggtcgcgct ggcgctgcgc       660
     gcggtcggcc tgcccatcgg gcgcgccgtg ctggtggcgg tggcgtcggg gctgatggag       720
     ccgctgggcg cgctggtggg cgtgggcatt tccagcggct ttgcgctggc gtatccgatc       780
     agcatgggcc tggccgccgg ggcgatgatc ttcgtggtct cgcacgaagt gattcccgag       840
     acgcatcgca acgggcatga gaccaccgcc acggtgggcc tgatggccgg tttcgcgctg       900
     atgatgttcc tggataccgc gctgggctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page