(data stored in ACNUC1104 zone)

EMBL: BX640427.PE5

BX640427.PE5         Location/Qualifiers
FT   CDS_pept        3367..4881
FT                   /transl_table=11
FT                   /locus_tag="BPP1296"
FT                   /product="ABC transport protein, solute binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2594"
FT                   /db_xref="GOA:Q7WAS2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS2"
FT                   /protein_id="CAE36598.1"
FT                   /translation="MMSKTGKMAAALAALCLSVGLAGAARAESTLQVALFTSLNSLDPN
FT                   VTTLGEEYVFNGLVFGGLTRIDANSKVVPDLAVSWTPSADLREWTFKLRPGVKFHHGKP
FT                   LTASDVVFSFQRIVDPATGSPGRTQLEVMKSVDAPDDATVHFTLTQPYADFPGLLTGRQ
FT                   LRVVAQDRIDTIKTQPSGTGPFRFVRYTPGDQLELERNPDYYDKDRIKIDRVVMRVMPE
FT                   AAARVAALRSGSIDMIWNLPLETIPDLKKDAAVVVDSVPSASWDGIVLNNSKPPFNDVR
FT                   VRRAVFLALDKKELVNFALFGEGSPTHSPIAPTDPAFNKDIGFAPDLAQAKQLLAEAGY
FT                   AKGFAVDIFVPAGRPSRERLGVAAQQLLRPLGIKLNVQRVPYNRYSAGVAGIAPMYVDG
FT                   FFASPVIDAATSPWFYSTGSWNARMWHFSSKRVDQALDAARASTDRAEQIRHYQDFQRA
FT                   LTEEVPGVIGYVTNVATAYRADIKNYHTNPFLWLDLYDVEKTGGAR"
     atgatgagca agacgggaaa gatggcggcc gcgctggccg cgctgtgctt gagcgtgggc        60
     ctggccggcg ccgcgcgggc ggagtcgacg ctgcaggtgg ccctgttcac cagcctgaac       120
     agcctggacc ccaacgtcac gacgctgggc gaggagtatg tgttcaacgg gctggtgttc       180
     ggcgggctga cccgcatcga cgccaactcc aaggtggtgc ccgacctggc ggtaagctgg       240
     acgccgtcgg ccgatctgcg cgaatggacg ttcaagctgc ggcccggggt gaagttccac       300
     catggcaagc cgctgacggc cagcgatgtg gtgttttcgt tccagcgcat cgtcgacccg       360
     gcgaccggct cgcccggccg cacgcagctg gaggtgatga agtcggtgga cgcgcccgat       420
     gacgccacgg tgcatttcac cctgacgcag ccgtatgccg attttcccgg cttgctgacc       480
     ggccgccagt tgcgcgtggt ggcgcaggat cgcatcgaca ccatcaagac ccagcccagc       540
     gggacgggcc cgttccgctt cgtgcgctat acgccgggcg accagctcga gctggagcgc       600
     aatcccgatt actacgacaa ggaccgcatc aagatcgacc gggtggtgat gcgcgtcatg       660
     cccgaggcgg ccgcgcgcgt ggcggccttg cgctcgggca gcatcgacat gatctggaac       720
     ctgccgctgg agaccattcc ggacctgaag aaggacgccg cggtagtggt ggactcggtg       780
     cccagcgcca gctgggatgg catcgtgctg aacaactcca agccgccgtt caatgatgtg       840
     cgggtgcgcc gcgcggtgtt cctggcgctg gacaagaagg agctggtgaa cttcgcgctg       900
     ttcggcgagg gctcgcccac ccacagcccg atcgcgccga ccgatcccgc gttcaacaag       960
     gatatcggct ttgcccccga cctggcgcag gccaagcagt tgctggccga ggccggctat      1020
     gccaagggtt tcgcggtgga catcttcgtg ccggcgggcc ggccttcgcg cgaacggctg      1080
     ggcgtggccg cgcagcagct gctgcggccg ctggggatca agctgaacgt gcagcgggtg      1140
     ccttacaacc gctattcggc tggcgtggcg ggaatcgcgc ccatgtatgt ggatggcttt      1200
     ttcgccagcc cggtgatcga cgcggcgacg tcgccctggt tctacagcac gggttcgtgg      1260
     aacgcgcgca tgtggcattt ctcgagcaag cgcgtggacc aggcgctgga cgcggcgcgc      1320
     gccagcaccg accgcgccga gcagatccgc cactaccagg atttccagcg cgcgctcacc      1380
     gaggaggtgc cgggcgtgat cggctacgtg accaatgtcg ccacggccta ccgcgccgac      1440
     atcaagaact accacaccaa tcccttcctc tggctcgacc tgtacgacgt cgagaaaacc      1500
     ggcggggcgc gctga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page