(data stored in ACNUC1104 zone)

EMBL: BX640427.PE53

BX640427.PE53        Location/Qualifiers
FT   CDS_pept        complement(51759..52106)
FT                   /transl_table=11
FT                   /locus_tag="BPP1344"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2134"
FT                   /db_xref="GOA:Q7WAN0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN0"
FT                   /protein_id="CAE36646.1"
FT                   /translation="MHYHGSCHCGTIRFDVEGELTGAMSCNCSICRRKGALLWFVPRDH
FT                   LRLATPDEQIATYTFNRHLIKHRFCPTCGIHTHGEGVDQQGRAMAAINIRCLDDVDLDA
FT                   VAVHQYDGRAA"
     atgcactatc acggcagttg ccattgcggc accatccgat tcgacgtgga aggcgaactg        60
     acaggcgcca tgtcctgcaa ttgctcgata tgccggcgca agggcgcgct gctgtggttc       120
     gtgccgcgcg accacctgcg gctggccacg cccgacgaac agatcgccac ctataccttc       180
     aaccgccacc tgatcaagca ccgcttctgt cccacgtgcg gcatccacac ccatggcgaa       240
     ggcgtcgacc agcaaggccg ggcgatggcg gcgatcaata tccgctgcct ggacgacgtg       300
     gacctggacg cggtcgccgt gcatcagtac gacggccgcg cggcatag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page