(data stored in ACNUC1104 zone)

EMBL: BX640427.PE55

BX640427.PE55        Location/Qualifiers
FT   CDS_pept        complement(53593..54012)
FT                   /transl_table=11
FT                   /locus_tag="BPP1346"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2132"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM8"
FT                   /protein_id="CAE36648.1"
FT                   /translation="MPQISAYLMFDGDCAEAMRLYERILGGKLDALITYGESPPEMPCE
FT                   PQDRDLIMHARLRLDDQLLMASDSNSQCPYEGKKGFSLSLVYPTVSDAQRIFNALAEGG
FT                   QVTMPLQKTFWAEIFGVLVDRHGTAWMISGGQMNS"
     atgccgcaaa tttccgcgta tctcatgttc gacggcgatt gcgccgaggc catgcgcctg        60
     tacgagcgca tcctgggcgg caagctggac gccttgatca cctacggcga aagcccgccc       120
     gagatgccct gcgagccgca ggaccgcgat ctgatcatgc acgcgcgcct gcgcctcgat       180
     gaccagctgc tgatggcctc cgacagcaac agccaatgcc cgtacgaagg caagaaaggc       240
     ttttcgctgt cgctcgtcta cccgaccgtc tccgacgcgc agcgcatctt caacgcgctg       300
     gccgagggcg gccaggtcac catgccgctg cagaaaacct tctgggccga aatcttcggc       360
     gtgctggtcg accgccacgg cacggcgtgg atgatcagcg gcggccagat gaacagctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page