(data stored in ACNUC1104 zone)

EMBL: BX640427.PE56

BX640427.PE56        Location/Qualifiers
FT   CDS_pept        54163..54771
FT                   /transl_table=11
FT                   /locus_tag="BPP1347"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2131"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="PDB:1ZBO"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM7"
FT                   /protein_id="CAE36649.1"
FT                   /translation="MAEIPLFPLSNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVV
FT                   VLEQGTEVRRPDGREVLARAGTMARIDHWEAPMPALLELACTGTGRFRLHACTQGKYGL
FT                   WTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPHIMPMAAPFRLDDCGWVA
FT                   DRWAEMLSLPPADKARLLLLPPLDRLREIDAVLAADGHA"
     atggccgaga ttccattatt tccattgagc aacgccttgt ttcctgcggg cgtgctgcgc        60
     ctgcgggtgt tcgagatccg ttatctcgac atggtcaggc gctgcatcgc cgacggctcc       120
     gagttcggcg tcgtggtgct ggagcagggc accgaagtgc gccgccccga tggccgcgag       180
     gtgctggcgc gcgccggcac catggcgcgc atcgaccatt gggaagcgcc catgccggcg       240
     ctgctggaac tggcctgcac cggtaccggg cgattccggc tgcacgcttg tacccagggc       300
     aagtacggcc tgtggaccgg ccaggccgag ccggtgcccg acgatgcgcc gctggaagtg       360
     ccgccggaac tggcgcgcag cgcctcggcg ctggggcgcc tgatcgcccg cctgcagcgc       420
     gagggcgtgc cgcctcacat catgcccatg gccgcgccgt tccggctcga cgactgcggc       480
     tgggtggccg accgctgggc cgagatgctg tcgctgccgc cggccgacaa ggcgcgtctg       540
     ctattgttgc cgccgctgga caggctgcgc gagatcgacg cggtgctggc cgccgacggg       600
     cacgcctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page