(data stored in ACNUC1104 zone)

EMBL: BX640427.PE57

BX640427.PE57        Location/Qualifiers
FT   CDS_pept        54784..55602
FT                   /transl_table=11
FT                   /locus_tag="BPP1348"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2130"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM6"
FT                   /protein_id="CAE36650.1"
FT                   /translation="MTGTMTIRIDEELRAYIDPLTPDEYAALEQSLLAEGCRDALVLWG
FT                   DLLVDGHNRHAICSKHGIAFNTVQNTRLQSMDDVRLWMIDNHLGRRSVSDFQRGVLALR
FT                   KKEILESRRQAGAGDAALAGGDGPAPLTRQTLARQARLSSTTLGQIEKIRQQAAPELVR
FT                   AVQSGEISINAAAAVATLPAPQQAAAAAGGRGELRAAARQVREARLPVRRASEAEPAPA
FT                   AEPRVVDDYPAEVARLDRLVAQLAEERDALKKKVVQLTVALAEARAKPGD"
     atgacgggaa ccatgaccat ccggatcgac gaagaactgc gggcctacat cgacccgctg        60
     acgcctgacg aatacgcggc gctggagcaa agcctgctgg ccgagggctg ccgcgacgcg       120
     ctggtgctgt ggggcgacct gctggtcgac ggccacaacc gccacgccat ttgcagcaag       180
     cacggtatcg ctttcaatac ggtgcagaac acgcgcctgc agtccatgga cgatgtacgg       240
     ctatggatga tagacaacca cctggggcgg cgcagtgtgt cggacttcca gcgcggggtg       300
     ctggccctgc gcaagaagga gatcctggaa agccggcgcc aggccggcgc aggggacgcc       360
     gcgctggccg gcggcgacgg gcctgcgccg ctgacgcgcc agacgctggc gcgccaggcg       420
     cgcctgagca gcacgaccct gggccagatc gagaaaatcc gccagcaggc cgcgcccgaa       480
     ctggtgcgcg cggtgcaaag cggtgagatt tccatcaatg ccgccgcggc ggtggcgacc       540
     ttgccggcgc cgcagcaggc ggccgcggcc gcgggcgggc gcggcgagct gcgcgccgcc       600
     gcgcgccagg tgcgcgaggc gcgcctgccg gtacgccggg cgtccgaagc cgaaccggcg       660
     cccgcggccg agccgcgcgt ggtggacgac tatcccgccg aggtggcgcg gctggaccgc       720
     ctggtggcgc aactggccga agagcgcgac gccctgaaga agaaagtggt tcagctgacc       780
     gtggcgctgg ccgaggcgcg cgccaagccg ggcgactga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page