(data stored in ACNUC1104 zone)

EMBL: BX640427.PE60

BX640427.PE60        Location/Qualifiers
FT   CDS_pept        complement(57615..59828)
FT                   /transl_table=11
FT                   /locus_tag="BPP1351"
FT                   /product="putative exported oxidoreductase subunit"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2127"
FT                   /db_xref="GOA:Q7WAM3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM3"
FT                   /protein_id="CAE36653.1"
FT                   /translation="MRIAIQNLSRRRFVQGAGGLLLGLSLPPLARRAMAAGPQAGDGFA
FT                   ANAFVRIGADGRITVLAKHLEKGQGAYTGLATLLAEELDADWRQVRVEGAPADSARYGN
FT                   QALGGLQGTGGSTAMFDSWEPMRRAGATARAMLVQAAAQRWQVPADTIEVAEGVLSHPA
FT                   SGRRAGFGELAEAAARSPVPEDVPLKDPARFRLIGKHRLPRVDSAAKSDGSALYTQDMK
FT                   LPGMLVAVVAHAPRLGAAVARVDDAAARAVPGVRAVVRFGGAALRHAGVAVLATNTWAA
FT                   RAGRDALRIEWDEGLAYRQGSADILARYREAVGRPGSMAARKGDIDAAFAGAAKVIEAE
FT                   YTYPYLAHAAMEPLNCLVRLDDERCEIWNGEQFQTADQRAIAQYLGMPAERITLTQLYA
FT                   GGSFGRRASSHADYLLEAVAIARTARAQGLNAPVKLVWMREDDMRAGYYRPLNLHRARL
FT                   ALGADGALQAVHVRMAGQSILLGTPLADWVRDGVDPVSVEGLSDLAYAVPNLQVELHTP
FT                   TDVPVPVLWYRSVGHTHTAFSAETLIDEAAVAAGQDPVAYRLALLAAHPRHREVLQLAA
FT                   ARAGWREPLAAGAPGTRRGRGVAVHESFRSVVAQVVEVTIAADGALKVDRVVCAVHCGL
FT                   AVNPDVVRAQMEGGIGFALSTALHGAITLKDGAVEQSNFHDYPVLRLAEMPAVEVHIAP
FT                   STQPPTGVGEPGVPPLAPALANAIAQATGQRLRTLPLGTTVKA"
     atgcgcatcg ccatccagaa cctgagccgg cgccgtttcg tgcaaggcgc cggcggcctg        60
     ctgctgggcc tgtcgctgcc gccgctggcc cgccgcgcca tggccgccgg cccgcaggcg       120
     ggcgacggtt tcgccgccaa cgccttcgtg cgcatcggcg ccgacggccg gatcaccgtc       180
     ctggccaagc acctggagaa gggccagggg gcctataccg gcctggccac gctgctggcc       240
     gaggagctcg acgccgattg gcgccaggtg cgcgtcgagg gcgccccggc cgacagcgcg       300
     cgctacggca accaggcgct gggcggcctg cagggcaccg gcggcagcac cgccatgttc       360
     gactcgtggg aacccatgcg gcgcgccggc gccaccgcgc gcgccatgct ggtgcaagcc       420
     gccgcgcagc gctggcaagt gccggccgac acgatcgagg tggccgaggg cgtgctcagc       480
     cacccggcct cgggacgccg cgccggcttc ggcgagctgg ccgaggccgc cgcgcgctcg       540
     cccgtgcccg aggacgtgcc gctcaaggac ccggcccgct tccggctgat cggcaaacat       600
     cgcctgccgc gcgtcgacag cgccgccaag agcgacggca gcgccctcta cacgcaggac       660
     atgaagctgc ccggcatgct ggtggcggtg gtggcgcatg cgccgcgcct gggcgcggcg       720
     gtggcgcgcg tcgatgacgc cgccgcccgg gcggtgcccg gcgtgcgcgc cgtggtccgc       780
     ttcggcggcg ctgcgctgcg ccacgccggc gtggccgtgc tggccaccaa tacctgggcc       840
     gcgcgggccg ggcgcgatgc gctgcggatc gagtgggacg agggcctggc ctaccgccag       900
     ggcagcgccg acatcctggc ccggtaccgc gaggccgtcg gccggcccgg cagcatggcg       960
     gcgcgcaagg gcgacatcga cgccgccttc gcgggcgcgg ccaaggtcat cgaggccgaa      1020
     tacacgtatc cgtatcttgc gcatgcggcc atggagccgc tgaactgcct ggtgcggctg      1080
     gacgacgaac gctgcgagat ctggaacggc gagcagttcc agacggccga ccagcgcgcc      1140
     atcgcgcagt atctcggcat gccggccgag cgcatcacct tgacccagct gtacgccggc      1200
     ggcagcttcg gccgccgcgc cagctcgcat gccgactacc tgctggaggc ggtcgccatc      1260
     gcgcgcaccg cgcgcgccca gggcctgaac gcgccggtca agctggtgtg gatgcgcgag      1320
     gacgacatgc gcgccggcta ctaccggccg ctcaacctgc accgcgcgcg gctggcgctc      1380
     ggcgccgacg gcgcgctgca ggcggtgcac gtgcgcatgg ccggccaatc gatcctgctg      1440
     ggcacgccgc tggcggactg ggtgcgcgac ggcgtcgacc cggtctcggt cgagggcctg      1500
     tccgacctcg cctacgcggt gcccaacctg caggtggagc tgcatacgcc caccgatgtg      1560
     cccgtgccgg tcctgtggta ccgctcggtg gggcacacgc atacggcgtt ctccgccgaa      1620
     accctgatcg acgaggccgc cgtggcggcc ggccaggacc cggtggccta tcgcctggcc      1680
     ctgctggccg cgcacccgcg ccaccgcgaa gtgctgcaac tggcggccgc ccgcgccggc      1740
     tggcgcgaac cgctggcggc cggcgcgcca ggcacgcgcc gcggccgcgg cgtggcggtg      1800
     catgaatcgt tccgctcggt ggtggcgcag gtggtcgaag tgaccattgc cgccgacggc      1860
     gcgctcaagg tggaccgggt cgtatgcgcc gtgcattgcg gcctggccgt caatccggac      1920
     gtggtgcgcg cgcagatgga aggcggcatc ggctttgccc tgtccaccgc cctgcacggc      1980
     gccatcacgc tgaaggacgg cgcggtcgag cagagcaact tccacgacta cccggtgctg      2040
     cgcctggccg aaatgccggc cgtcgaagtg catatcgcgc cgtccacgca gccgcccacc      2100
     ggcgtgggcg agccgggcgt gccgccgctg gcgccggccc tggccaacgc catcgcccag      2160
     gccaccggcc agcgcctgcg cacgctgccg ctgggcacca ccgtcaaggc atga            2214
//

If you have problems or comments...

PBIL Back to PBIL home page