(data stored in ACNUC1104 zone)

EMBL: BX640427.PE64

BX640427.PE64        Location/Qualifiers
FT   CDS_pept        61915..62964
FT                   /transl_table=11
FT                   /locus_tag="BPP1355"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2124"
FT                   /db_xref="GOA:Q7WAM0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM0"
FT                   /protein_id="CAE36657.1"
FT                   /translation="MRRRRAGRAAGIMAVVRYDIPGALMSDSLVFHTDLPGLADGPWHG
FT                   GELAMQERAGARERMAQLGPRVIRDYMPQQHRDFFAQLPFMLLATVDAQGDPWASVLEG
FT                   PPGFAHSPDERTLRLDAWPAGDDPARAGLAHGAGVGMLGIELSTRRRNRVNGHVAALDG
FT                   QGFCVVVTQSFGNCPQYIQTRHARQAAPAPQPARWLAGLDAAARTLVGQADTLFVASYA
FT                   RQAGPHAVDVSHRGGPPGFVHLRGDTLTMPDFSGNRFFNTLGNLLANPRAGLVFVDFAR
FT                   GDLLQLCGRAEVLAEAGAPAAYPGAQRLWRVHVERAVRRPAALGLRAGFGEYAAQLAAV
FT                   GQWAGEPPA"
     ttgcgccggc gccgcgcggg ccgcgcggcg ggcatcatgg cggttgttcg atacgacatt        60
     cccggtgcct tgatgagcga ttcgctggtt ttccataccg atctccctgg cctggccgac       120
     ggcccctggc atggcggcga gctggccatg caggagcgcg ccggcgcgcg cgaacgcatg       180
     gcgcaattgg ggccgcgcgt catccgcgac tacatgccgc agcagcatcg cgatttcttt       240
     gcccagctgc cgttcatgct gctggccacg gtcgatgcgc aaggcgaccc ctgggccagc       300
     gtgctggagg ggccgccggg tttcgcgcac agccccgacg agcgcacctt gcgcctggat       360
     gcctggcccg ccggcgacga ccccgcgcgc gccggcctgg cgcatggcgc cggcgtgggc       420
     atgttgggca tcgagctgtc cacgcggcgg cgcaatcgcg tcaacggcca tgtcgccgcg       480
     ctggacggac aggggttctg cgtggtggtg acgcagtcgt tcggcaactg cccgcaatac       540
     atacagaccc gccatgcgcg tcaggccgcg cccgcgccgc agccggcgcg ctggctggcg       600
     ggcctggacg cggccgcgcg cacgctggtc gggcaggctg atacgctgtt cgtggccagc       660
     tacgcgcgcc aggccggccc gcacgcggtg gacgtgtcgc atcggggcgg gccgcccggc       720
     ttcgtgcacc tgcgcggcga tacgctgacg atgccggatt tctccggcaa tcgcttcttc       780
     aataccctgg gcaatctgct ggccaatccg cgcgccggcc tggtgttcgt ggatttcgcg       840
     cgcggcgact tgctgcagct gtgcgggcgc gccgaagtgc tggccgaggc cggggcgccc       900
     gcggcgtatc cgggcgccca gcgcctgtgg cgcgtccacg tggagcgggc ggtgcgccgg       960
     cccgcggcgc tggggctgcg ggccgggttc ggcgagtatg ccgcgcagct ggcggccgtg      1020
     gggcaatggg ccggcgagcc gccggcctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page