(data stored in ACNUC1104 zone)

EMBL: BX640427.PE70

BX640427.PE70        Location/Qualifiers
FT   CDS_pept        67324..68019
FT                   /transl_table=11
FT                   /locus_tag="BPP1361"
FT                   /product="probable glutathione S-transferase"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   glutathione S-transferase Pa1033 SWALL:Q9I4U1
FT                   (EMBL:AE004536) (213 aa) fasta scores: E(): 1.6e-60, 71.42%
FT                   id in 203 aa, and to Anabaena sp. hypothetical protein
FT                   All1124 SWALL:Q8YXT7 (EMBL:AP003584) (232 aa) fasta scores:
FT                   E(): 4.8e-62, 67.25% id in 226 aa"
FT                   /db_xref="GOA:Q7WAL4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL4"
FT                   /protein_id="CAE36663.1"
FT                   /translation="MIDLYFWATPNGLKIKLFLEEAGLPYTEHPINIGKGEQFQREFLA
FT                   IAPNNRIPAIVDQAPAGGGAPISLFESGAILLYLAEKIGRFIPADVRGRAEVLQWLFWQ
FT                   MGGLGPMAGQNGHFNVYAPEKVPYAIERYTAETARLYDVMDRRLAEREFLAGEYSIADI
FT                   ACYPWVVPHEAHGQKMAHFPHLSRWFEAIAARPATARAYKEAGDSYRPKAPMSDEERAV
FT                   LFGQPGAPR"
     atgattgatc tgtatttctg ggccacgccc aatggtttga aaataaaact cttcctggaa        60
     gaggccggcc tgccctatac cgagcacccg atcaacatcg gcaagggcga gcagttccag       120
     cgcgaattcc tcgcgatcgc gcccaacaac cgcattcccg ccatcgtcga ccaggcgccg       180
     gctggcggcg gcgcgccgat ctcgttgttc gagtccggcg ccatcctgct gtacctggcc       240
     gagaagatcg gccgcttcat ccccgccgac gtgcgcggcc gcgccgaagt cctgcagtgg       300
     ctgttctggc agatgggcgg gctggggccc atggccggcc agaatgggca tttcaacgtc       360
     tatgcccccg agaaggtgcc gtacgccatc gaacgctaca cggccgaaac cgcgcgcctg       420
     tacgacgtga tggaccggcg cctggccgag cgcgagttcc tggcgggcga gtactcgatc       480
     gccgatatcg cctgctatcc ctgggtcgtg ccgcacgagg cgcacggcca gaagatggcc       540
     catttcccgc acctgagccg ctggttcgag gcgatcgccg cgcggcccgc cacggcgcgc       600
     gcctataagg aggccggcga cagctaccgg cccaaggcgc ccatgtcgga cgaggaacgg       660
     gccgtactgt tcggccagcc gggcgcgccg cgctag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page