(data stored in ACNUC1104 zone)

EMBL: BX640427.PE72

BX640427.PE72        Location/Qualifiers
FT   CDS_pept        69588..70298
FT                   /transl_table=11
FT                   /locus_tag="BPP1363"
FT                   /product="putative GNAT-family acetyltransferase"
FT                   /note="Similar to Brucella melitensis
FT                   ribosomal-protein-serine acetyltransferase Bmeii0002
FT                   SWALL:Q8YE16 (EMBL:AE009639) (242 aa) fasta scores: E():
FT                   1.2e-49, 58.9% id in 219 aa, and to Rhizobium loti
FT                   hypothetical protein Mll2986 SWALL:Q98H84 (EMBL:AP003000)
FT                   (228 aa) fasta scores: E(): 4.3e-49, 56.05% id in 223 aa"
FT                   /db_xref="GOA:Q7WAL3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL3"
FT                   /protein_id="CAE36665.1"
FT                   /translation="MSARVNEFGQPIGQAMPQWQARPRPPRDPAEGRYCRLEPLDAARH
FT                   GDDLYAAFAVPDAASGWTYLSAGPFADRAGYDEYLRKAADSADPLHHAVIDLASGRAIG
FT                   TLSLMRIDPANGVIEVGHVNFAPALRRSPASTEAQYLLMRRAFDELGYRRYEWKCDSLN
FT                   APSRAAALRLGFLFEGIFRQALVYKGRTRDTAWFSIIDSEWPALRAAFERWLAPENFDA
FT                   AGRQRKRLDACRQP"
     atgtcagccc gcgtcaacga attcggtcaa cccatcggcc aggccatgcc gcaatggcag        60
     gcgcggccgc gtcccccgcg cgatcccgcc gagggccgct attgccggct cgaaccgctc       120
     gacgccgcgc gccacggcga tgatctgtac gcggcctttg cggtgcccga cgcggccagc       180
     ggctggacct atctgtcggc cggcccgttc gccgaccgcg ccggctacga cgaatacctg       240
     cgcaaggcgg ccgacagcgc cgatcccctg caccacgcgg tgatcgacct ggccagcggg       300
     cgcgcgatcg gcacgctgtc gctgatgcgc atcgatccgg ccaacggcgt gatcgaagtg       360
     gggcatgtga acttcgcgcc ggcgctgcgg cgctcgccgg cttcgaccga ggcgcagtac       420
     ctgctgatgc ggcgcgcctt cgacgaactg ggctaccgcc gctacgaatg gaagtgcgac       480
     agcctgaacg cgccctcgcg cgcggccgcg ctgcgcctgg gtttcctgtt cgagggcatt       540
     ttccgccagg cgctggtcta caaggggcgt acgcgcgaca ccgcgtggtt ctccatcata       600
     gacagcgaat ggccggcgct gcgggcggcg ttcgagcggt ggctggcgcc ggagaacttc       660
     gatgcggcgg gccgccagcg caagcggctg gatgcctgcc gccagccgta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page