(data stored in ACNUC1104 zone)

EMBL: BX640427.PE73

BX640427.PE73        Location/Qualifiers
FT   CDS_pept        complement(70401..71327)
FT                   /transl_table=11
FT                   /locus_tag="BPP1364"
FT                   /product="integral membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1411 SWALL:Q9I3T3 (EMBL:AE004570) (303 aa) fasta
FT                   scores: E(): 3.7e-60, 59.67% id in 305 aa, and to Ralstonia
FT                   solanacearum hypothetical transmembrane protein Rsc0519 or
FT                   Rs04969 SWALL:Q8Y218 (EMBL:AL646059) (301 aa) fasta scores:
FT                   E(): 7.5e-54, 55.44% id in 303 aa"
FT                   /db_xref="GOA:Q7WAL2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL2"
FT                   /protein_id="CAE36666.1"
FT                   /translation="MAAAAPLRRPLDGFATYVMLALCICWGFQQIAIKLVAADVSPTLQ
FT                   IGLRSAFAAVVLIWVVLRHEGLGALRDGTLGPGLAVGALFALEFLLVGVGLEYTTASHM
FT                   AVFLYTAPIFTALGLHLLLPDERLKPLQWLGVAVAFGGIATAFLGKGHAAVPGMLLGDL
FT                   LGVLAGAAWGATTVAIRKSSLSEAAPAKTLFYQMLMAGLALPAFHFASGGAAPVWSGAA
FT                   LASLGFQSVVVALSSYLAWFWLLRRYLATRLAVLSFMTPLFGVTFGVLILDEPLDSGFV
FT                   IGAVLVLAGITLVSGAELLREKLRRRT"
     atggccgccg ccgcgccgct gcgccgtccg ctggacggtt tcgccactta cgtcatgctg        60
     gcgctgtgca tctgctgggg cttccagcag atcgccatca agctggtggc cgccgatgtc       120
     tcccccaccc tgcagatcgg cctgcgctcg gccttcgccg cggtggtgct gatctgggtg       180
     gtgctgcgcc acgaaggcct gggcgcgttg cgcgacggca cgctggggcc cggcctggcg       240
     gtgggcgcgc tgttcgcgct ggaattcctg ctggtcggcg tgggcctgga gtacaccacc       300
     gcctcgcaca tggcggtatt cctctacacc gcgcccatct tcacggcgct cgggctgcat       360
     ctgctgctgc ccgacgaacg cctcaagccg ctgcagtggc tgggcgtggc ggtggccttc       420
     ggcggcatcg ccaccgcctt cctgggcaag ggccacgcgg ccgtgcccgg catgctgctg       480
     ggcgacctgc tcggcgtgct ggccggcgcg gcctggggcg ccaccacggt ggcgatccgc       540
     aaatcctcgc tgtccgaggc ggcgccggcc aagactctgt tctaccagat gctgatggcc       600
     ggactggccc tgcccgcctt tcatttcgcc agcggcggcg ccgcgcccgt ctggtccggc       660
     gcggccctgg ccagcctggg cttccagtcg gtggtcgtgg cgctgtcgag ctacctggcc       720
     tggttctggc tgctacgccg ctatctcgcc acccgcctgg cggtgctgtc gttcatgacg       780
     ccgctgttcg gcgtcacctt cggcgtgctg atcctcgacg agccgctgga ctcgggcttc       840
     gtcatcggcg cggtgctggt gctggccggc atcacgctgg tcagcggcgc cgagctgctg       900
     cgcgagaagc tgcggcgccg gacataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page