(data stored in ACNUC1104 zone)

EMBL: BX640427.PE8

BX640427.PE8         Location/Qualifiers
FT   CDS_pept        6676..8310
FT                   /transl_table=11
FT                   /locus_tag="BPP1299"
FT                   /product="ABC transport protein, ATP-binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2591"
FT                   /db_xref="GOA:Q7WAS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS0"
FT                   /protein_id="CAE36601.1"
FT                   /translation="MHQDTILNIKGLEVRYGRNQVLHGVDLELPRGASLGIVGESGSGK
FT                   STIAWTVLGLLPPGAAVTAGSVAFDGEDITGERAAGLRGDRIAMVFQDPFTALNPSLPV
FT                   GRQITEALVERGRADARSARAEALRLMDEVRLPRASTLLDAYPHQLSGGMKQRIVIATA
FT                   LACSPDLLLLDEPTTALDVTVEARILDLLDELRVQRGLSMVFISHNIGLVERMCSRVTV
FT                   MHGGRVQEAGAAQQVLWHPAHAYTRKLLAALPLLEKRAPAVPAVGAPIARVRDVRLTFR
FT                   PAHPLGGWARLLRLPRAEGVAALAGVSLELRPREVVGLVGESGSGKSTLGRCLVGLQAP
FT                   DAGTVELSDHDVYRASPEVARRLRRQSQMVFQNPDSSLNPRQRVGEVLRRLLQLMGLDR
FT                   RQQDRRMDELLDLVRLPAAYAERYPHQLSGGEKQRVGIARTLALEPSVLVCDEATSALD
FT                   VSVQASILELLKDLRDRLGVAMLFISHDLAVVSQISDRVVVMRHGAIVEQGRTDQVLSA
FT                   PAHEYTRLLLDSVPAFVARRAREAAVA"
     atgcaccaag acactatcct gaatatcaag ggcctggagg tgcgctacgg ccgcaaccag        60
     gtgctgcatg gcgtggatct cgaattgccg cgcggcgcgt cgctgggcat cgtgggcgag       120
     agcggctcgg gcaagagcac gattgcctgg acggtgctgg gcctgttgcc gcccggcgcg       180
     gcggtcaccg ccggcagcgt ggccttcgac ggcgaggaca tcacgggaga acgcgccgcc       240
     gggctgcgcg gcgaccgcat tgccatggtg ttccaggacc catttaccgc gctcaatccc       300
     agcctgcccg tcggccgcca gatcaccgag gcgctggtcg aacgcgggcg cgccgatgcc       360
     cgcagcgcgc gcgccgaagc cctgcggctg atggacgagg tgcgcctgcc gcgcgccagt       420
     acgttgctgg acgcctatcc gcaccagttg tccggcggca tgaagcagcg catcgtgatc       480
     gccacggcgc tggcctgctc gcccgacttg ctgctgctcg acgagccgac caccgcgctc       540
     gacgtcacgg tggaagcccg catcctggat ctgctggacg agttgcgggt gcagcgcggc       600
     ctgagcatgg tcttcatcag ccacaacatc ggtttggtcg agcgcatgtg ctcgcgcgtg       660
     acggtcatgc acggcgggcg cgtgcaggaa gccggcgccg cgcagcaggt gctgtggcat       720
     cccgcccatg cctacacccg caagctgctg gctgccttgc cgctgctgga aaagcgcgcg       780
     ccggccgtgc cggccgtcgg cgcgccgatc gcgcgcgtgc gcgacgtgcg cctgacattc       840
     cggcccgccc atccgctggg cggctgggcc aggctgctgc gcctgccgcg cgccgaaggc       900
     gtggcggccc tggccggcgt gtcgctggaa ctgcggccgc gcgaagtggt gggcctggtg       960
     ggcgagagcg ggtcgggcaa gtcgaccctg ggccgctgcc tggtcggcct gcaagcgccg      1020
     gatgcgggca cggtcgagct gtccgaccac gatgtgtacc gcgccagccc ggaggtggcg      1080
     cgccggctgc ggcgccagtc gcagatggtg ttccagaatc ccgactcctc gctcaacccg      1140
     cgccagcgcg tgggcgaggt gttgcgccgc ctgctgcaat tgatggggct ggatcgccgc      1200
     cagcaggatc gccgcatgga cgagctgctg gatctggtgc gcctgccggc ggcctacgcc      1260
     gagcgctatc cgcaccagct cagcggcggg gaaaagcagc gcgtgggcat tgcccgcacg      1320
     ctggcgctgg agccttcggt gctggtgtgc gacgaagcca cttcggcgct ggacgtgtcg      1380
     gtgcaggcgt cgatcctgga gctgctcaag gacttgcgcg accggctggg cgtggcgatg      1440
     ctgttcatct cgcatgatct ggcggtggtg tcgcagatat ccgatcgggt ggtggtgatg      1500
     cgccatggcg ccatcgtcga gcaggggcgc accgatcagg tgctcagcgc cccggcccac      1560
     gagtacacgc ggctgctgct cgacagcgtg ccggctttcg tggcgcgccg cgcgcgggag      1620
     gcggccgtgg cctga                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page