(data stored in ACNUC1104 zone)

EMBL: BX640427.PE80

BX640427.PE80        Location/Qualifiers
FT   CDS_pept        complement(77796..78659)
FT                   /transl_table=11
FT                   /locus_tag="BPP1371"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Rb0265 or Smb20275 SWALL:Q92WR4 (EMBL:AL603642) (286 aa)
FT                   fasta scores: E(): 3.6e-47, 51.31% id in 267 aa, and to
FT                   Ralstonia solanacearum hypothetical protein Rsc0083 or
FT                   Rs02257 SWALL:Q8Y397 (EMBL:AL646057) (281 aa) fasta scores:
FT                   E(): 9e-35, 54.48% id in 279 aa"
FT                   /db_xref="GOA:Q7WAK5"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK5"
FT                   /protein_id="CAE36673.1"
FT                   /translation="MSPSLFAAGAQAALADSPLIVTVAPNGAYKTAADHPAVPLTAAAL
FT                   AAEARACLDAGAAMMHMHVRTPEGRHSLDVAAYREALAAVRQAVGEELLVQVTSEAAGV
FT                   YRAAEQMAMVRELRPEAVSMGLREIAVPEMPERELADFLAWVAAERIMAQIILYDAADV
FT                   ARWQALRARGLAPEGAWSVLFVLGRYSAGQVSSPRDLLPFLEVYDGSLPWAVCAFGREE
FT                   NACVATAAAFGGHMRVGFENNLKLSDGATAPGNAALVAQAAQAGRVLGRPIATAAQARE
FT                   IYGRLA"
     atgagcccgt cgctgttcgc cgcgggcgcg caggccgcgc tggccgactc gcccctgatc        60
     gtcacggtgg cgcccaatgg cgcctacaag accgccgccg accaccccgc cgtgccgctg       120
     acggcggcgg cgctggcggc cgaggcgcgc gcctgcctgg acgccggcgc ggccatgatg       180
     cacatgcatg tgcgcacgcc cgaaggccgc cattcgctgg acgtggcggc ctaccgcgag       240
     gcgctggcgg cggtgcgcca ggccgtgggc gaagaactgc tggtgcaggt caccagcgaa       300
     gcggctggcg tctaccgcgc cgccgagcag atggccatgg tgcgcgaact gcgccccgaa       360
     gccgtttcga tgggcctgcg cgagatcgcc gtgcccgaga tgccagaacg cgagctggcc       420
     gacttcctgg cctgggtcgc agccgaacgc atcatggcgc agatcatcct gtacgacgcc       480
     gccgacgtgg ccaggtggca ggcgctgcgc gcgcgcggcc tggcgcctga aggagcctgg       540
     tcggtgctgt tcgtgctggg ccgctactcg gccggccagg tgtcctcgcc gcgcgacctg       600
     ctgccctttc tcgaggtcta cgacggatcg ctgccctggg ccgtgtgcgc cttcggccgc       660
     gaagagaacg cctgcgtggc caccgcggcc gcgttcggcg gccatatgcg ggtgggcttc       720
     gagaacaacc tcaagctgag cgacggcgcg accgcgccgg gcaacgccgc cctggtggcc       780
     caggccgcgc aggctggccg cgtgctgggc cggcccatcg ccaccgccgc gcaggcgcgc       840
     gagatctacg gacgcctggc atag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page